IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ thpaut-2021-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins MGL identified as Clec10a or CD301 from PMID: 31248427 rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus thpaut-2021-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus thpaut-2021-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. tem transmission electron microscopy tem predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus thpaut-2021-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT clc4m_human C-type lectin domain family 4 member M CD209 antigen-like protein 1 Dendritic cell-specific ICAM-3-grabbing non-integrin 2 DC-SIGN-related protein Liver/lymph node-specific ICAM-3-grabbing non-integrin CLEC4M CD209L CD209L1 CD299 protein protein human Homo sapiens Human MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE q8iun9-2 C-type lectin domain family 10 member A CLEC10A CLECSF13 CLECSF14 HML C-type lectin superfamily member 14 Macrophage lectin 2 protein protein human Homo sapiens Human MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH clc4k_human C-type lectin domain family 4 member K CD207 CLEC4K Langerin protein protein human Homo sapiens Human MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP pm26 PM26 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) s-cd209-3 4060464 N/A 4060468 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4060469 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false 2, Table 1 Non-oriented-11.90uM; Oriented-4.33uM s-clec4m-3 4060464 N/A 4060470 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4060469 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false 2, Table 1 Non-oriented-1.80uM; Oriented-1.66uM s-clec10a-2 4060464 N/A 4060471 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 4060469 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false 4060464 2, Table 1 Non-oriented 7.0uM s-cd207-1 4060464 N/A 4060472 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false OmpA signal peptide tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 4060469 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false 2, Table 1 Langerin has an affinity of at least one order of magnitude lower than L/DC-SIGN. s-cd209-5 4060464 N/A 4060473 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4060468 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4060469 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false 4060464 6 B/C, Supp. figure S2. s-82 4060465 N/A 4060469 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. Stoichiometry: 3.0 direct interaction direct interaction false false false 1c Sample quality and trimeric assembly were confirmed by 2D class averages of the Spike protein. s-cd209-4 4060465 N/A 4060468 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 4060469 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. Stoichiometry: 1.0 direct interaction direct interaction false false false 3C Most images show a 1:1 complex but, in some cases, (Fig 3C, left) at least two molecules of DC-SIGN interacting with the spike protein can be detected. cd209-s-11 4060465 N/A 4060468 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 4060469 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. Stoichiometry: 2.0 direct interaction direct interaction false false false 3C Most images show a 1:1 complex but, in some cases, (Fig 3C, left) at least two molecules of DC-SIGN interacting with the spike protein can be detected. s-83 4060466 N/A 4060469 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 4060469 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false 1D-G cd209-s-12 4060467 N/A 4060468 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4060469 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false Supp. figure 1C The spike protein interacts with various numbers of DC-SIGN ECD.