DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ valencia_snchez-2021-1 ecoli Escherichia coli (strain K12) 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Valencia-Sánchez MI., Abini-Agbomson S., Wang M., Lee R., Vasilyev N., Zhang J., De Ioannes P., La Scola B., Talbert P., Henikoff S., Nudler E., Erives A., Armache KJ. karim-jean.armache@nyulangone.org Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation valencia_snchez-2021-2 ecoli Escherichia coli (strain K12) bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink experimental particp experimental participant identification experimental particp Valencia-Sánchez MI., Abini-Agbomson S., Wang M., Lee R., Vasilyev N., Zhang J., De Ioannes P., La Scola B., Talbert P., Henikoff S., Nudler E., Erives A., Armache KJ. karim-jean.armache@nyulangone.org Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation d2xb49_gbmv MAR_ORF414 protein protein GBM Marseillevirus marseillevirus MLAQIHPDISVQTEALSELSNIAVFLGKKISHGAVTLLPEGTKTIKSSAVLLAAGDLYGKDLGRHAVGEMTKAVTRYGSAKESKEGSRSSKAKLQISVARSERLLREHGGCSRVSEGAAVALAAAIEYFMGEVLELAGNAARDSKKVRISVKHITLAIQNDAALFAVVGKGVFSGAGVSLISVPIPRKKARKTTEKEASSPKKKAAPKKKKAASKQKKSLSDKELAKLTKKELAKYEKEQGMSPGY d2xb48_gbmv MAR_ORF413 protein protein GBM Marseillevirus marseillevirus MARKNLVQSFSLVQTVMSKAGKKVKAQQHGHLADHVSVGETQIPKASTQHLLRKAGSLSAAGDTEVPIRGFVHMKLHKLVQKSLLAMQLAKRKTIMKSDVKKAAELMHLPVFAIPTKDSGAKGSVFLSCRQKGAGSAGTGSETNSQEVRSQMRSTCLIIPKERFRTMAKEISKKEGHDVHIAEAALDMLQVIVESCTVRLLEKALVITYSGKRTRVTSKDIETAFMLEHGPL valencia_snchez-2021-2 4079180 N/A 4079182 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 4079183 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified HisTag HisTag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig 1, Extended Data Table 2 d2xb48_gbmv-d2xb49_gbmv-1 4079181 N/A 4079182 predetermined predetermined participant predetermined mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 4079183 predetermined predetermined participant predetermined mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified HisTag HisTag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Extended Data Fig. 1