UniProt UniProt http://www.uniprot.org xiang-2020-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. qukai001@xjtu.edu.cn Theranostics 2020 Only protein-protein interactions imex curation imex curation xiang-2020-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. qukai001@xjtu.edu.cn Theranostics 2020 Only protein-protein interactions imex curation imex curation xiang-2020-3 human-smmc7721 Human SMMC7721 Hepatoma cell line smmc7721 SMMC7721 Hepatoma cell line This cell line originated in China prior to 1980. No PMID reference findable but:- Tong R et al., The establishment and primary biological characteristics of human hepatoma SMMC-7721 cell line.J 2nd Milit Med Univ, 1980;1(1):5-9. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. qukai001@xjtu.edu.cn Theranostics 2020 Only protein-protein interactions imex curation imex curation xiang-2020-4 human-mhcc97h human-MHCC97H -highly metastatic subclone of MHCC97 Human mhcc97h MHCC97H -highly metastatic subclone of MHCC97 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. qukai001@xjtu.edu.cn Theranostics 2020 Only protein-protein interactions imex curation imex curation foxm1_human Forkhead box protein M1 Hepatocyte nuclear factor 3 forkhead homolog 11 Winged-helix factor from INS-1 cells M-phase phosphoprotein 2 MPM-2 reactive phosphoprotein 2 Transcription factor Trident Forkhead-related protein FKHL16 WIN FOXM1 FKHL16 HFH11 MPP2 protein protein human Homo sapiens Human MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ a0a455zar2_human circPINTexon2 hCG_1645276 protein protein human Homo sapiens Human MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK circpintexon2-foxm1-1 4110056 N/A 4110060 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 4110061 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5B, Supp. Fig. 4B foxm1-circpintexon2-1 4110057 N/A 4110060 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate N/A 4110061 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5B, Supp. Fig. 4B circpintexon2-foxm1-2 4110058 N/A 4110060 unspecified role unspecified role neutral component neutral component cell lysate cell lysate fixed cell fixed cell N/A 4110061 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5C circpintexon2-foxm1-3 4110059 N/A 4110060 unspecified role unspecified role neutral component neutral component cell lysate cell lysate fixed cell fixed cell N/A 4110061 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5C