IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ toto-2020-1 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Toto A., Ma S., Malagrinò F., Visconti L., Pagano L., Stromgaard K., Gianni S. Chromatin - Epigenetic interactions resulting in chromatin modulation PALS1 is of Human species origin based on figure 1A (PDB: 4UU5). However no sequence or expression system is stated. stefano.gianni@uniroma1.it Protein science : a publication of the Protein Society 2020 imex curation imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions toto-2020-2 in vitro In vitro 2d-ir 2d-infrared spectrometry 2d-ir tag fluorescence tag visualisation by fluorescence tag fluorescence Toto A., Ma S., Malagrinò F., Visconti L., Pagano L., Stromgaard K., Gianni S. Chromatin - Epigenetic interactions resulting in chromatin modulation T‐jump kinetic binding experiment;for the measurement of very rapid reaction rates. Rapid change in temperature was driven by capacitive electrical discharge and detection was by fluorescence. PALS1 is of Human species origin based on figure 1A (PDB: 4UU5). However no sequence or expression system is stated. stefano.gianni@uniroma1.it Protein science : a publication of the Protein Society 2020 imex curation imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions vemp_sars2 Envelope small membrane protein E 4 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV pals1_human Protein PALS1 PALS1 MAGUK p55 subfamily member 5 MPP5 Membrane protein, palmitoylated 5 Protein associated with Lin-7 1 protein protein human Homo sapiens Human MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV e-mpp5-7 4050485 N/A 4050487 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050488 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain false PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range false direct interaction direct interaction false false false 4050485 2 A mpp5-e-6 4050485 N/A 4050489 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050488 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain false PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range false direct interaction direct interaction false false false 4050485 2 A mpp5-e-8 4050485 N/A 4050487 competitor competitor competitor unspecified role unspecified role PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050487 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050488 unspecified role unspecified role fluorescence donor fluorescence donor PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range false Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4050485 2 D mpp5-e-9 4050485 N/A 4050489 competitor competitor competitor unspecified role unspecified role PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050489 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050488 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain false PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range false direct interaction direct interaction false false false 4050485 2 D mpp5-e-7 4050486 N/A 4050487 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050488 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain false PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range false direct interaction direct interaction false false false 4050486 2 B/C mpp5-e-5 4050486 N/A 4050489 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4050488 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain false PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range false direct interaction direct interaction false false false 4050486 2 B