UniProt UniProt http://www.uniprot.org chitwood-2020-1 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Chitwood PJ., Hegde RS., Chitwood PJ., Hegde RS. rhegde@mrc-lmb.cam.ac.uk Nature 2020 IMEx Only protein-protein interactions imex curation imex curation chitwood-2020-2 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chitwood PJ., Hegde RS., Chitwood PJ., Hegde RS. rhegde@mrc-lmb.cam.ac.uk Nature 2020 IMEx Only protein-protein interactions imex curation imex curation aster_human PAT complex subunit Asterix WDR83OS WD repeat domain 83 opposite strand WDR83 opposite strand CGI-140 My006 PTD008 C19orf56 Protein associated with the ER translocon of 10kDa protein protein human Homo sapiens Human MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW ccd47_human PAT complex subunit CCDC47 CCDC47 Calumin Coiled-coil domain-containing protein 47 GK001 MSTP041 PSEC0077 protein protein human Homo sapiens Human MKAFHTFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEILMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM ccdc47-wdr83os-1 4086066 N/A 4086068 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 4086069 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 2A ccdc47-wdr83os-2 4086067 N/A 4086068 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 4086069 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 2D