UniProt UniProt http://www.uniprot.org sabath-2020-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-8 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight by staining molecular weight estimation by staining weight by staining Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. Disuccinimidyl suberate (DSS) was used to covalently link lysine residues with a distance between C-alpha atoms of less than 26-30 A. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-9 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. Disuccinimidyl suberate (DSS) was used to covalently link lysine residues with a distance between C-alpha atoms of less than 26-30 A. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-10 trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. pull down pull down experimental particp experimental participant identification experimental particp Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-4 in vitro In vitro crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. Disuccinimidyl suberate (DSS) was used to covalently link lysine residues with a distance between C-alpha atoms of less than 26-30 A. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-2 trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. pull down pull down western blot western blot Immuno blot Immuno blot Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-3 trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation sabath-2020-7 in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Nature communications 2020 Only protein-protein interactions imex curation imex curation int14_human Integrator complex subunit 14 VWA9 INTS14 C15orf44 von Willebrand factor A domain-containing protein 9 protein protein human Homo sapiens Human MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLWELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLGIGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQSTDSLECLERLIDLNNGEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPLPWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKILRNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPETAHPDAAFQLTHAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERI int10_human Integrator complex subunit 10 INTS10 C8orf35 protein protein human Homo sapiens Human MSAQGDCEFLVQRARELVPQDLWAAKAWLITARSLYPADFNIQYEMYTIERNAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRVQCEMLLKVTEQCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQESPVNCFRKLFVCDVLPLIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQIENQHQGAQDTSDLMSPSKRSSQKYIIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGDVEIDRNKHIHKKRKLAEGREKTMSSDDEDCSAKGRNRHIVVNKAELANSTEVLESFKLARESWELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILLLQTLT int13_human Integrator complex subunit 13 INTS13 ASUN C12orf11 Cell cycle regulator Mat89Bb homolog GCT1 Germ cell tumor 1 Protein asunder homolog Sarcoma antigen NY-SAR-95 protein protein human Homo sapiens Human MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGEFMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ int11_human Integrator complex subunit 11 INTS11 CPSF3L Cleavage and polyadenylation-specific factor 3-like protein Protein related to CPSF subunits of 68 kDa RC68 protein protein human Homo sapiens Human MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS int7_human Integrator complex subunit 7 INTS7 C1orf73 protein protein human Homo sapiens Human MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPILINSAFLKLADVFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAHHSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPILQHMHHDAILASSARQLLQQLVTSYPSTKMVIVSLHTFTLLAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLANKTPHTWSRENIQALCECALQTPYDSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQECCYHNNRGIAAHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLAKGRPHLSQSVVETLLTQLHSAQDAARILMCHCLAAIAMQLPVLGDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVASEHFYFWLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKGIASLTAASTPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIATTIAMTLGNDLQRCGRISNQMKQSMEEFRSLASRYGDLYQASFDADSATLRNVELQQQSCLLISHAIEALILDPESASFQEYGSTGTAHADSEYERRMMSVYNHVLEEVESLNRKYTPVSYMHTACLCNAIIALLKVPLSFQRYFFQKLQSTSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQHGSKPGLFRKIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILGTHNITVESSVKDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYTRF int1_human Integrator complex subunit 1 INTS1 KIAA1440 UNQ1821/PRO3434 protein protein human Homo sapiens Human MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAISPSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLSLMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENWPEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGSEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNNMQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCLGLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGHLAAASTKQTITESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQSMPWLADLVQSSEGSLDVLPVQCLCEFLLHDAVDDAASGEEDDEGESKEQKAKKRQRQQKQRQLLGRLQDLLLGPKADEQTTCEVLDYFLRRLGSSQVASRVLAMKGLSLVLSEGSLRDGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTALALQQAIHMETDPQTISAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKLSPSAASDAVLSALLSIFSRYVRRMRQSKEGEEVYSWSESQDQVFLRWSSGETATMHILVVHAMVILLTLGPPRADDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVDAALQDLEPQQLLLFVQSFGIPVSSMSKLLQFLDQAVAHDPQTLEQNIMDKNYMAHLVEVQHERGASGGQTFHSLLTASLPPRRDSTEAPKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSPRPVALALQQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLACPLLRQLCQYQRCVPQDTGFSSLFLKVLLQMLQWLDSPGVEGGPLRAQLRMLASQASAGRRLSDVRGGLLRLAEALAFRQDLEVVSSTVRAVIATLRSGEQCSVEPDLISKVLQGLIEVRSPHLEELLTAFFSATADAASPFPACKPVVVVSSLLLQEEEPLAGGKPGADGGSLEAVRLGPSSGLLVDWLEMLDPEVVSSCPDLQLRLLFSRRKGKGQAQVPSFRPYLLTLFTHQSSWPTLHQCIRVLLGKSREQRFDPSASLDFLWACIHVPRIWQGRDQRTPQKRREELVLRVQGPELISLVELILAEAETRSQDGDTAACSLIQARLPLLLSCCCGDDESVRKVTEHLSGCIQQWGDSVLGRRCRDLLLQLYLQRPELRVPVPEVLLHSEGAASSSVCKLDGLIHRFITLLADTSDSRALENRGADASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLSCFLHVLGLLELLQPHVFRSEHQGALWDCLLSFIRLLLNYRKSSRHLAAFINKFVQFIHKYITYNAPAAISFLQKHADPLHDLSFDNSDLVMLKSLLAGLSLPSRDDRTDRGLDEEGEEESSAGSLPLVSVSLFTPLTAAEMAPYMKRLSRGQTVEDLLEVLSDIDEMSRRRPEILSFFSTNLQRLMSSAEECCRNLAFSLALRSMQNSPSIAAAFLPTFMYCLGSQDFEVVQTALRNLPEYALLCQEHAAVLLHRAFLVGMYGQMDPSAQISEALRILHMEAVM u1_human_snrna Human U1 spliceosomal RNA snrna small nuclear rna snRNA snrna human Homo sapiens Human AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGUGCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCCCCUG Rfam xref RF00003 hsur4_shv2c_mirna mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA shv2c Saimiriine herpesvirus 2 (strain 488) (SaHV-2) Herpesvirus saimiri u12_snrna_human U12 small nuclear (RNU12) snrna small nuclear rna snRNA snrna human Homo sapiens Human int9_human Integrator complex subunit 9 INTS9 RC74 Protein related to CPSF subunits of 74 kDa protein protein human Homo sapiens Human MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF int4_human Integrator complex subunit 4 MSTP093 INTS4 protein protein human Homo sapiens Human MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQNEKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSLEKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKLLSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRVQAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPKEEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMFNDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKEGIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMDDPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVSPSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFSATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVVIIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKLLDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGLVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSHTAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKPARR ints13-ints10-3 3977669 N/A 3977680 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977681 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977682 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9NVM9:p.[Thr53Glu;Met102Glu;Leu328Glu;Tyr330Gly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Thr53Glu;Met102Glu;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 3B ints14-ints10-1 3977669 N/A 3977682 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977681 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977680 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q96SY0:p.[Ser264Glu;Trp362Glu;Pro371Glu;Tyr399Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe256Glu;Leu312Glu;Pro371Glu;Tyr399Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Ser264Glu;Phe256Glu;Leu312Glu;Trp362Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 3C,3D ints14-ints13-2 3977669 N/A 3977682 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977680 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3D ints13-ints14-6 3977669 N/A 3977680 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977682 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Gly] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3977683 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977684 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977685 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 5C ints13-ints1-1 3977669 N/A 3977682 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3977683 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977684 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977685 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 5C, Supp. Fig. 7A ints13-ints14-9 3977669 N/A 3977681 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977680 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977682 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9NVM9:p.[Thr53Glu;Met102Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Leu328Glu;Tyr330Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.Ile395_Leu396delinsGluGlu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false Supp. Fig. 5A ints13-ints14-1 3977670 N/A 3977680 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977682 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9NVM9:p.[Thr53Glu;Met102Glu;Leu328Glu;Tyr330Gly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Thr53Glu;Met102Glu;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Thr53Glu;Met102Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Leu328Glu;Tyr330Gly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Ile395Glu;Leu396Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NVM9:p.[Phe418Glu;Leu427Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1A, 2I, Supp. Fig. 1D ints14-ints13-1 3977670 N/A 3977682 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977680 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q96SY0:p.[Pro371Glu;Tyr399Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Ser264Glu;Trp362Glu;Pro371Glu;Tyr399Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe256Glu;Leu312Glu;Pro371Glu;Tyr399Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe256Glu;Ser264Glu;Leu312Glu;Trp362Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe447Glu;Phe449Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Ser264Glu;Trp362Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.Leu272Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe256Glu;Leu312Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1B, 2J, Supp. Fig. 1E ints14-ints10-2 3977670 N/A 3977681 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977680 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q96SY0:p.[Ser264Glu;Trp362Glu;Pro371Glu;Tyr399Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe256Glu;Leu312Glu;Pro371Glu;Tyr399Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Phe256Glu;Ser264Glu;Leu312Glu;Trp362Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false vwa region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Asp8Ala;Ser10Ala;Ser12Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96SY0:p.[Leu11Glu;Arg15Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3C, 3D, 3H ints13-ints13-1 3977670 N/A 3977682 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977682 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 4E ints14-ints13-4 3977670 N/A 3977680 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3977680 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 4E u1_human_snrna-1 3977671 N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977686 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false stem loop 4 region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fug. 4A, 4B u1_human_snrna-ints10-1 3977671 N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977681 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977686 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false stem loop 4 region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fug. 4A, 4B hsur4_shv2c_mirna-ints10-1 3977671 N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977681 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977687 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 6K In low salt condition the complex displays 18-fold higher affinity for the RNA. hsur4_shv2c_mirna-ints13-1 3977671 N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977687 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 6K In low salt condition the complex displays 18-fold higher affinity for the RNA. u1_human_snrna-ints13-1 3977672 N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977686 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3977672 Fig. 4E, 4F, Supp Fig 6G In low salt condition the complex displays 7-fold higher affinity for the RNA. u1_human_snrna-ints10-2 3977672 N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977681 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977686 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3977672 Fug. 4E, 4F, Supp Fig. 6G, 6H In low salt condition the complex displays 18-fold higher affinity for the RNA. u12_snrna_human-ints10-1 3977672 N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977681 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977688 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3977672 Supp Fig. 6I, 6J u12_snrna_human-ints13-1 3977672 N/A 3977680 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977688 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3977672 Supp Fig 6I, 6J ints1-ints10-1 3977673 N/A 3977680 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977682 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977681 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977683 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977689 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977690 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977684 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977685 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3A ints11-ints4-5 3977673 N/A 3977683 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977689 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977690 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3A ints10-ints13-1 3977673 N/A 3977680 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977682 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3977681 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3A ints13-ints14-5 3977674 N/A 3977683 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977689 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977690 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977681 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false Fig. 5A ints13-ints11-1 3977674 N/A 3977683 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977689 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977690 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977680 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false Fig. 5A ints13-ints11-2 3977674 N/A 3977683 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977689 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977690 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false Fig. 5B, Supp. Fig. 7B ints13-ints14-7 3977675 N/A 3977680 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 2.0 N/A 3977682 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 4D ints13-ints14-8 3977675 N/A 3977680 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 3.0 N/A 3977682 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 3.0 direct interaction direct interaction false false false Supp. Fig. 4D ints13-ints14-10 3977675 N/A 3977681 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 2.0 N/A 3977680 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 2.0 N/A 3977682 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 2.0 physical association physical association false false false Supp. Fig. 5B ints13-ints14-4 3977676 N/A 3977680 unspecified role unspecified role neutral component neutral component purified purified Q96SY0:lys-394 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-394 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-442 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-386 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-425 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-386 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-435 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96SY0:lys-425 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977682 unspecified role unspecified role neutral component neutral component purified purified Q9NVM9:lys-73 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-437 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-549 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-436 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-437 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-507 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-436 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-35 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-454 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-35 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 3977920 3977908 3977921 3977907 3977922 3977909 3977923 3977910 3977924 3977911 3977925 3977912 3977926 3977913 3977927 3977914 3977928 3977915 3977929 3977916 3977930 3977917 3977931 3977918 direct interaction direct interaction false false false Fig. 1G, Supp Data 1 ints11-ints13-1 3977676 N/A 3977682 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-690 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-690 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977683 unspecified role unspecified role neutral component neutral component purified purified Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-292 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-223 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-292 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-224 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-419 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-475 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-223 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-303 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-475 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-234 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-486 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-292 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977689 unspecified role unspecified role neutral component neutral component purified purified Q9NV88:lys-159 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-170 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-374 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-193 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-170 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-159 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q9NV88:lys-170 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3977690 unspecified role unspecified role neutral component neutral component purified purified Q96HW7:lys-324 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-217 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-324 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-437 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-157 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-198 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-495 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-157 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-959 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-217 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-164 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 3977968 3977938 3977969 3977939 3977970 3977940 3977976 3977945 3977977 3977960 3977978 3977961 3977979 3977962 3977980 3977963 3977981 3977964 3977982 3977965 3977983 3977966 3977984 3977967 3977986 3977942 3977987 3977943 3977988 3977944 3977989 3977973 3977990 3977946 3977991 3977947 3977992 3977948 3977993 3977949 3977994 3977950 3977995 3977951 3977996 3977952 3977997 3977953 3977998 3977954 3977999 3977955 3978000 3977956 3978001 3977957 3978002 3977958 3978003 3977959 3978004 3977972 3978005 3977974 3978006 3977975 3978007 3977936 3978008 3977937 physical association physical association false false false Supp.Fig.7C, Supp.Table 2 ints13-ints14-2 3977677 N/A 3977680 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 3977682 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1C, Supp. Fig. 1A ints13-ints14-3 3977678 N/A 3977680 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3977682 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 direct interaction direct interaction false false false Fig. 1D, Supp Table 1 ints14-ints13-3 3977679 N/A 3977681 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ecoli Escherichia coli (strain K12) N/A 3977680 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3E