MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint connolly-2019-1 drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Connolly KJ., O'Hare MB., Mohammed A., Aitchison KM., Anthoney NC., Taylor MJ., Stewart BA., Tuxworth RI., Tear G., Connolly KJ., O'Hare MB., Mohammed A., Aitchison KM., Anthoney NC., Taylor MJ., Stewart BA., Tuxworth RI., Tear G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. R.I.Tuxworth@bham.ac.uk Scientific reports 2019 Only protein-protein interactions imex curation imex curation connolly-2019-2 drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Connolly KJ., O'Hare MB., Mohammed A., Aitchison KM., Anthoney NC., Taylor MJ., Stewart BA., Tuxworth RI., Tear G., Connolly KJ., O'Hare MB., Mohammed A., Aitchison KM., Anthoney NC., Taylor MJ., Stewart BA., Tuxworth RI., Tear G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. R.I.Tuxworth@bham.ac.uk Scientific reports 2019 Only protein-protein interactions imex curation imex curation q9vs51_drome Cln7 Dmel\CG8596 cln7 Dmel_CG8596 CG8596 CLN7 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEFARRVSARFETKRLPEDVDDGLETLEEYKQRWRSVRIIYFTMFLMALGFSIILTGIWPYLNKLDPDAGKEFMGLIVAANPLGQMIFSPIFGWWGNKLGKIRLPLLLSLSLFTLASGIYSSLELRPDNVKYWMLSSRFLIGVSSANIALCRSYLSAATRISERTHAVAMVSLAQVLGFIIGPTLQAAVTPLGDQGHVWLWGKMHFNMYTASGWINVLMSIGNFMMFLPGVFEEHKIAAREVMVMQGGTSEKETWKGIKPSYLSAWTLIVAFFVLVFNFVLLETLGTSLTMDMFAWSNDEALWYMGIMMTTAAIVSLVTFVLIEPMCKIIAERYVLIWGGFSLMFLGRVLFVPWGPDPPKLAQPFNASWNLSESDPIFLGCPTTQKWCGELPALTLTQFIIGFAFTSIGYPIGVTLIQTIFSKVLGPRPQGVWMGWMTGSGCLSRVLGPVFVGSIYTRLGTFWTFGVTSAMMLVSMFWLQCSNRLLIPPTFEKTTPVELKELNKHNGSKLLDDHSPDTHNGSPPEDLSPDQPILGKHGSQHSISHA rheb_drome GTP-binding protein Rheb homolog Rheb CG1081 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS cln7-1 3978684 N/A 3978686 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3978687 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f6d cln7-rheb-1 3978684 N/A 3978686 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3978687 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f6d rheb-cln7-1 3978685 N/A 3978687 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3978686 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false sf2