UniProt UniProt http://www.uniprot.org chu-2019-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-10 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. Prey with a SAINT score <0.9 or present in the CRAPome database were filtered out of this interaction asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. proximity-dependent biotin identification proximity-dependent biotin identification western blot western blot Immuno blot Immuno blot Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-5 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-6 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-7 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation chu-2019-9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Nature communications 2019 Only protein-protein interactions imex curation imex curation clcc1_human Chloride channel CLIC-like protein 1 CLCC1 KIAA0761 MCLC Mid-1-related chloride channel protein 1 protein protein human Homo sapiens Human MLCSLLLCECLLLVAGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGDMHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETWKWRFEDSFGVDPYNVLMVLLCLLCIVVLVATELWTYVRWYTQLRRVLIISFLFSLGWNWMYLYKLAFAQHQAEVAKMEPLNNVCAKKMDWTGSIWEWFRSSWTYKDDPCQKYYELLLVNPIWLVPPTKALAVTFTTFVTEPLKHIGKGTGEFIKALMKEIPALLHLPVLIIMALAILSFCYGAGKSVHVLRHIGGPESEPPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGEGTPKESSTESSQSAKPVSGQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGPRGQDPVSSPCG pios1_human Protein PIGBOS1 PIGBOS1 PIGB opposite strand protein 1 protein protein human Homo sapiens Human MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESEEKKS pios1_rat Protein PIGBOS1 PIGB opposite strand protein 1 homolog Pigbos1 protein protein rat Rattus norvegicus (Rat) Rat MLRRLTRPQLLFAAALGVAGGMYIYQPIFEQYSRDQKELKEKVKILQESEEKRS pigbos1-clcc1-2 3979403 N/A 3979412 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3979413 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figs. 3B pigbos1-clcc1-4 3979403 N/A 3979412 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3979413 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figs. 3E pigbos1-clcc1-6 3979403 N/A 3979412 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3979413 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false A0A0B4J2F0:p.Glu30_Tyr32delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Lys34_Gln36delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Lys37_Leu39delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Lys40_Lys42delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Met43_Leu45delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Val46_Glu48delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Ser49_Glu51delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A0A0B4J2F0:p.Lys52_Ser54delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp. Figs. 6C, 15A Endoplasmic reticulum stress, induced by treatment with tunicamycin or thapsigargin has no effect on the PIGBOS-CLCC1 interaction pigbos1-pigbos1-1 3979404 N/A 3979413 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3979413 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp. Figs. 19B pigbos1-pigbos1-2 3979404 N/A 3979414 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3979413 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp. Figs. 19C clcc1-pigbos1-5 3979404 N/A 3979412 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3979413 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp. Fig 3B pigbos1-clcc1-1 3979405 N/A 3979412 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3979413 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figs. 3A, 3B, Supp Data 1, Supp Tables 1 and 2 pigbos1-clcc1-3 3979406 N/A 3979412 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3979413 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminus tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figs. 3C, 3D, Supp. figure 3A pigbos1-clcc1-5 3979407 N/A 3979412 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3979413 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figs. 4A, Supp. Fig. 10C clcc1-pigbos1-1 3979408 N/A 3979412 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3979413 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figs. 4B clcc1-pigbos1-2 3979409 N/A 3979412 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3979413 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figs. 4B clcc1-pigbos1-3 3979410 N/A 3979412 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3979413 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figs. 4C, 4E. Overexpression of VAPB and PTPIP51 ER-mitochondria contact site proteins significantly increased interactions between PIGBOS and CLCC1 clcc1-pigbos1-4 3979411 N/A 3979412 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3979413 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp. Figs. 12A, 15B Overexpression of VAPB and PTPIP51 ER-mitochondria contact site proteins significantly increased interactions between PIGBOS and CLCC1 Endoplasmic reticulum stress, induced by treatment with tunicamycin or thapsigargin has no effect on the PIGBOS-CLCC1 interaction