UniProt UniProt http://www.uniprot.org ozdeslik-2019-1 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation ozdeslik-2019-2 human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation ozdeslik-2019-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation ozdeslik-2019-4 human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation opn3_human Opsin-3 Encephalopsin Panopsin OPN3 ECPN protein protein human Homo sapiens Human MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL mshr_human Melanocyte-stimulating hormone receptor MC1R MSHR Melanocortin receptor 1 protein protein human Homo sapiens Human MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCSW mc1r-opn3-1 4057851 N/A 4057855 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4057856 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 7A, Supp. figure 5. opn3-mc1r-1 4057851 N/A 4057855 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4057856 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 7A opn3-mc1r-2 4057852 N/A 4057855 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4057856 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 7B mc1r-opn3-2 4057853 N/A 4057855 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4057856 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 6A, Supp Fig. 7A opn3-mc1r-3 4057854 N/A 4057855 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4057856 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 6D, Supp. Fig. 7C