UniProt UniProt http://www.uniprot.org albarran-2017-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Albarran L., Lopez JJ., Jardin I., Sanchez-Collado J., Berna-Erro A., Smani T., Camello PJ., Salido GM., Rosado JA. Source of proteins taken from previous work of the same authors (SARAF PMID: 27068144 and STIM1 PMID: 30975919) also PMID: 23943619· ijp@unex.es Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2017 Only protein-protein interactions imex curation imex curation albarran-2017-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Albarran L., Lopez JJ., Jardin I., Sanchez-Collado J., Berna-Erro A., Smani T., Camello PJ., Salido GM., Rosado JA. Source of proteins taken from previous work of the same authors (SARAF PMID: 27068144 and STIM1 PMID: 30975919) also PMID: 23943619· ijp@unex.es Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2017 Only protein-protein interactions imex curation imex curation crcm1_human Calcium release-activated calcium channel protein 1 ORAI1 CRACM1 TMEM142A Protein orai-1 Transmembrane protein 142A protein protein human Homo sapiens Human MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA stim1_human Stromal interaction molecule 1 STIM1 GOK protein protein human Homo sapiens Human MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK efhb_human EF-hand domain-containing family member B EFHB protein protein human Homo sapiens Human MNMEIGHPHEGKDDLGDKRVIMGTKFPMELGIRVGLGKEDSRCGESPVVSNKCEGRMAPPETKFPLSKGLEMGLERQNISRTVMQRGSLGVDSVSASQGTKPSLLPGRMGLENESLLAGYTHERIIQPPLGRVCGSSQAAGSRRAPLASGPEGVEELVGKPAFVMEPRQEMEKESTCVLMKPNTEIKLPVEVDIGLTQAEGPDETKNTEPQMGLVIEPPQCQFAQQHEQRKEAGNIESGVEPPDRIRPIYSGKFFDRTPCWPSAGKVIPVGYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQIAPYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPSSFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVLDELRHADRIKCKTLM saraf_human Store-operated calcium entry-associated regulatory factor SARAF HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 TMEM66 Transmembrane protein 66 XTP3 HSPC035 NPD003 PSEC0019 UNQ1967/PRO4499 protein protein human Homo sapiens Human MAAACGPGAAGYCLLLGLHLFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR stim1-orai1-3 4070118 N/A 4070120 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 4070121 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association false false false Fig.3B Thapsigargin (CHEBI:9516) Effect of Thapsigargin was overcome by depletion of EFHB and increased in cells expressing EFHB (residues 165-833) orai1-efhb-2 4070118 N/A 4070122 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070120 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.6C Thapsigargin (CHEBI:9516) dimethyl BAPTA impaired the TG-evoked increase in the EFHB-Orai1 association. stim1-efhb-2 4070118 N/A 4070123 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070122 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070121 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig.6B Treatment of the cells with Thapsigargin (CHEBI:9516) resulted in a significant initial decrease in SARAF-STIM1 interaction. Pretreatment of the cells with dimethy-BAPTA (CHEBI:60889) impaired the recovery of the SARAF-STIM1 interaction after 30 minutes. stim1-saraf-1 4070118 N/A 4070123 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070121 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.7A The inhibitory effect of Thapsigargin on this interaction was lost in EFHB depleted cells Thapsigargin (CHEBI:9516) stim1-efhb-3 4070118 N/A 4070122 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070121 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.6D Overexpression of SARAF significantly attenuated the TG-induced EFHB-STIM1 interaction. orai1-efhb-1 4070119 N/A 4070122 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4070120 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association false false false Fig.2A Thapsigargin (CHEBI:9516) stim1-efhb-1 4070119 N/A 4070122 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4070121 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association false false false Fig.2A Thapsigargin (CHEBI:9516) stim1-orai1-2 4070119 N/A 4070120 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 4070121 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association false false false Fig.3A, 4B Thapsigargin (CHEBI:9516) Effect of Thapsigargin was overcome by depletion of EFHB The interaction was increased in cells expressing EFHB (residues 165-833)