MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint rajavelu-2018-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation rajavelu-2018-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation rajavelu-2018-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation rajavelu-2018-3 mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation rajavelu-2018-4 in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation rajavelu-2018-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation p51608-1 Methyl-CpG-binding protein 2 MECP2 Beta protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS dnm3a_mouse DNA (cytosine-5)-methyltransferase 3A DNA methyltransferase MmuIIIA Cysteine methyltransferase DNMT3A Dnmt3a protein protein mouse Mus musculus Mouse MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKVGRPGRKRKHPPVESSDTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPAAGQKGGAPAEGEGTETPPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPACHDSDESDSGKAVEVQNKQMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA dnm3l_mouse DNA (cytosine-5)-methyltransferase 3-like Dnmt3l protein protein mouse Mus musculus Mouse MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS mecp2-dnmt3a-3 3987317 N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P51608-1:p.Arg306Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified mbp tag mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987335 3987331 direct interaction direct interaction false false false F2G SF14 Pull-down experiments in the presence of the non-specific and highly active nuclease from S. marcescens demonstrated that the interaction of both proteins was not mediated by nucleic acids (SupplementaryFigure S14). mecp2-dnmt3a-6 3987317 N/A 3987325 competitor competitor competitor neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987343 3987340 direct interaction direct interaction false false false F6B addition of histone H3 abolished the ADD–TRD interaction, suggesting that H3 and TRD binding to the ADD domain is mutually exclusive. mecp2-dnmt3a-7 3987317 N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987350 3987347 direct interaction direct interaction false false false F6B addition of histone H3 abolished the ADD–TRD interaction, suggesting that H3 and TRD binding to the ADD domain is mutually exclusive. mecp2-dnmt3a-2 3987317 N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O88508:p.Tyr522Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false O88508:p.Asp527Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987357 3987354 direct interaction direct interaction false false false SF13 SF16 The interaction between DNMT3A2 and GST-TRD is resistant to high salt washes. mecp2-dnmt3a-8 3987317 N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987366 3987363 direct interaction direct interaction false false false F2A mecp2-dnmt3l-1 3987317 N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987326 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false F2B mecp2-dnmt3a-1 3987318 N/A 3987323 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987379 3987376 direct interaction direct interaction false false false F1B F2F The interaction between DNMT3A2 and GST-TRD is resistant to high salt washes. mecp2-dnmt3a-4 3987318 N/A 3987323 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role prey prey purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987386 3987383 direct interaction direct interaction false false false F2E dnmt3a-14 3987319 N/A 3987323 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed YFP tag YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3987324 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1C dnmt3a-15 3987320 N/A 3987327 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3987324 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F1D mecp2-dnmt3a-5 3987321 N/A 3987323 unspecified role unspecified role fluorescence donor fluorescence donor purified purified n-terminus GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trd binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified mbp tag mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false add domain binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987401 3987398 direct interaction direct interaction false false false SF11 dnmt3a-mecp2-1 3987322 N/A 3987323 unspecified role unspecified role neutral component neutral component purified purified n-terminus GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trd binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3987324 unspecified role unspecified role neutral component neutral component purified purified mbp tag mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Add binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3987408 3987405 direct interaction direct interaction false false false SF12