DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kumar-2015-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kumar V., Chen Y., Ero R., Ahmed T., Tan J., Li Z., Wong AS., Bhushan S., Gao YG. ygao@ntu.edu.sg Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation kumar-2015-2 thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Kumar V., Chen Y., Ero R., Ahmed T., Tan J., Li Z., Wong AS., Bhushan S., Gao YG. ygao@ntu.edu.sg Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation bipa_eco27 50S ribosomal subunit assembly factor BipA bipA o591 typA E2348C_4177 GTP-binding protein BipA GTP-binding protein BipA/TypA Ribosome-dependent GTPase BipA Tyrosine phosphorylated protein A protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MIEKLRNIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTRFVTKKAFAYGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPIVYASALNGIAGLDHEDMAEDMTPLYQAIVDHVPAPDVDLDGPFQMQISQLDYNSYVGVIGIGRIKRGKVKPNQQVTIIDSEGKTRNAKVGKVLGHLGLERIETDLAEAGDIVAITGLGELNISDTVCDTQNVEALPALSVDEPTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRAPKDD rs7_thet8 30S ribosomal protein S7 rpsG rps7 TTHA1696 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW mint One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA rl11_thet8 50S ribosomal protein L11 rplK TTHA0247 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA This protein binds directly to 23S ribosomal RNA mint One of the L7 dimers in conjuction with L11 and its bound segment of 23S rRNA forms what is known as the L7/L12 stalk, which extends beyond the surface of the 70S ribosome. The stalk is preferentially stabilized in 70S versus 50S crystals In the 70S ribosome is in a position where it could interact transiently with the A site tRNA during translation rshx_thet8 30S ribosomal protein Thx rpsU S31 TTHA1396 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGKGDRRTRRGKIWRGTYGKYRPRKKK rs20_thet8 30S ribosomal protein S20 rpsT rps20 TTHA1397 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA rs19_thet8 30S ribosomal protein S19 rpsS TTHA1688 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK rs18_thet8 30S ribosomal protein S18 rpsR TTHA0243 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK rs17_thet8 30S ribosomal protein S17 rpsQ TTHA1683 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA rs16_thet8 30S ribosomal protein S16 rpsP TTHA1035 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA rs15_thet8 30S ribosomal protein S15 rpsO TTHA1138 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG rs14z_thet8 30S ribosomal protein S14 type Z rpsZ rpsN TTHA1679 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW rs13_thet8 30S ribosomal protein S13 rpsM rps13 TTHA1667 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK rs12_thet8 30S ribosomal protein S12 rpsL TTHA1697 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK rs11_thet8 30S ribosomal protein S11 rpsK rps11 TTHA1666 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS rs10_thet8 30S ribosomal protein S10 TTHA1693 rpsJ protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR rs9_thet8 30S ribosomal protein S9 rpsI rps9 TTHA1464 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR rs8_thet8 30S ribosomal protein S8 rpsH TTHA1678 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA rs5_thet8 30S ribosomal protein S5 rpsE TTHA1675 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG rs4_thet8 30S ribosomal protein S4 rpsD rps4 TTHA1665 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR rs3_thet8 30S ribosomal protein S3 rpsC rps3 TTHA1686 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE rs2_thet8 30S ribosomal protein S2 rpsB rps2 TTHA0861 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA rl36_thet8 50S ribosomal protein L36 rpmJ Ribosomal protein B TTHA1668 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG rl35_thet8 50S ribosomal protein L35 rpmI TTHA0552 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPYE rl34_thet8 50S ribosomal protein L34 rpmH rpl34 TTHA0446 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR rl33_thet8 50S ribosomal protein L33 rpmG rpl33 TTHA0250 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI rl32_thet8 50S ribosomal protein L32 rpmF rpl32 TTHA0418 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV rl31_thet8 50S ribosomal protein L31 rpmE TTHA1073 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR rl30_thet8 50S ribosomal protein L30 rpmD TTHA1674 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE rl29_thet8 50S ribosomal protein L29 rpmC TTHA1684 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA rl27_thet8 50S ribosomal protein L27 rpmA TTHA1782 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA rl25_thet8 50S ribosomal protein L25 rplY rpl25 rptL5 TTHA1589 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAEVAEPEVIKKGKEEEEE rl24_thet8 50S ribosomal protein L24 rplX TTHA1681 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE rl23_thet8 50S ribosomal protein L23 rplW TTHA1690 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI rl22_thet8 50S ribosomal protein L22 rplV TTHA1687 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK rl21_thet8 50S ribosomal protein L21 rplU TTHA1783 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIRG rl20_thet8 50S ribosomal protein L20 rplT TTHA0553 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG rl19_thet8 50S ribosomal protein L19 rplS TTHA1031 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADRKRIDQDRAAERAAKEEAQKAQEPKASQE rl18_thet8 50S ribosomal protein L18 rplR TL24 TTHA1676 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF rl17_thet8 50S ribosomal protein L17 rplQ rpl17 TTHA1663 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLAERRRGDGAPLALVELVE rl16_thet8 50S ribosomal protein L16 rplP TTHA1685 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ rl15_thet8 50S ribosomal protein L15 rplO TTHA1673 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA rl14_thet8 50S ribosomal protein L14 TTHA1682 rplN protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL rl13_thet8 50S ribosomal protein L13 rplM TTHA1465 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV rl10_thet8 50S ribosomal protein L10 rplJ TTHA0209 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFVAKNTLIRLALKELGLPELDGLQGPSAVVFYEDPVAAAKTLVQFAKSNPKGIPQVKSGLLQGQILTAKDVEALAELPTMDELRAELVGVLQAPMAELVGVLGGVARELVGILEAYAEKKAA rl6_thet8 50S ribosomal protein L6 rplF TTHA1677 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK rl5_thet8 50S ribosomal protein L5 rplE TTHA1680 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK rl4_thet8 50S ribosomal protein L4 L1e TTHA1691 rplD protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA rl3_thet8 50S ribosomal protein L3 rplC TTHA1692 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRETKKAAK rl2_thet8 50S ribosomal protein L2 rplB TTHA1689 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK rl1_thet8 50S ribosomal protein L1 rplA TTHA0246 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS bipa-1 3978520 N/A 3978522 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false Fig 2, Fig S3, Table S1 bipa-rpla-1 3978521 N/A 3978523 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978524 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978522 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978525 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978526 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978527 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978528 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978529 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978530 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978531 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978532 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978533 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978534 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978535 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978536 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978537 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978538 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978539 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978540 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978541 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978542 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978543 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978544 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978545 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978546 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978547 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978548 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978549 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978550 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978551 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978552 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978553 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978554 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978555 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978556 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978557 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978558 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978559 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978560 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978561 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978562 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978563 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978564 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978565 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978566 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978567 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978568 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978569 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978570 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978571 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3978572 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 association association false false false Fig 3, Fig S3, Table S1