MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gee-2015-2 rat-kidney-glomerulus rat kidney glomerulus kidney-glomerulus kidney glomerulus confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Gee HY., Zhang F., Ashraf S., Kohl S., Sadowski CE., Vega-Warner V., Zhou W., Lovric S., Fang H., Nettleton M., Zhu JY., Hoefele J., Weber LT., Podracka L., Boor A., Fehrenbach H., Innis JW., Washburn J., Levy S., Lifton RP., Otto EA., Han Z., Hildebrandt F. Pulldown in Fig. 6 was not captured as origin species of proteins was not provided. Friedhelm.Hildebrandt@childrens.harvard.edu The Journal of clinical investigation 2015 imex curation Only protein-protein interactions imex curation gee-2015-1 rat-kidney-glomerulus rat kidney glomerulus kidney-glomerulus kidney glomerulus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gee HY., Zhang F., Ashraf S., Kohl S., Sadowski CE., Vega-Warner V., Zhou W., Lovric S., Fang H., Nettleton M., Zhu JY., Hoefele J., Weber LT., Podracka L., Boor A., Fehrenbach H., Innis JW., Washburn J., Levy S., Lifton RP., Otto EA., Han Z., Hildebrandt F. Pulldown in Fig. 6 was not captured as origin species of proteins was not provided. Friedhelm.Hildebrandt@childrens.harvard.edu The Journal of clinical investigation 2015 imex curation Only protein-protein interactions imex curation kank2_rat KN motif and ankyrin repeat domain-containing protein 2 Kank2 protein protein rat Rattus norvegicus (Rat) Rat MAQVLHVPAPFPGTPGQASSAAFPNKEPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVPVQRRPRLGSLPRGPGSWWTSTESLCSDASGDSRHSAYSYCGRGFYPQYGALETRSGTNPRVERTLLDARRRLEDQAAAPSSGGLGSLTPSAAGSTSSLAGVGLLPPTPRSSGLSTPVAPSAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPSGTRSRSELCLDLPEAPDDPAVLETRSVGTWVRERDLGIPDGEAALVAKVAVLETQLKKALQELRAAQTQQVDLQPQAWPPPDTQVRVDTVRVVEGPREVEVAASTAAGAPAQRAQSLEPYGAGLKALATSAENTLVFRSHEVVETMCPLPTASTSNMHTAKKISITERNCTGAARMADPPPSPAEPSPSSPYPAAEPENPAPAAQDTTDRELTRPVASQDSQAAEGAGGASLGVQSALKRKEVPADPDVHQRNLQFVGINGGYESSSEDSSTAENSEHESTENEAPEPPVRVLSTAEGPQLRPLGPAVGKTSQDERQLSQESQRVPEAKVAPGPDPEEEIRMDLSPDLISACLALEKYLENPNALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVRQLLDSGVCQVDKLNRAGYSPIMLTALATLKTQDDIDTILQLFRLGNVNAKASQAGQTALMLAVSHGRVDVVKALLACEVDVNMQDEDGSTALMCACEHGHKEITGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSDYESPASSSAEE gdir1_rat Rho GDP-dissociation inhibitor 1 Arhgdia Rho-GDI alpha protein protein rat Rattus norvegicus (Rat) Rat MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHLSWEWNLTIKKEWKD rhoa_rat Transforming protein RhoA Rhoa Arha Arha2 protein protein rat Rattus norvegicus (Rat) Rat MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL arhgdia-kank2-1 4088155 N/A 4088157 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 4088158 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Fig. 5A arhgdia-kank2-2 4088155 N/A 4088157 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 4088159 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Fig. 5A arhdia-kank2-rhoa-1 4088156 N/A 4088157 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4088158 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4088159 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 5B