IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ nagae-2012-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp The Journal of cell biology 2012 imex curation Only protein-protein interactions imex curation nagae-2012-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp The Journal of cell biology 2012 imex curation Only protein-protein interactions imex curation nagae-2012-3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp The Journal of cell biology 2012 imex curation Only protein-protein interactions imex curation itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK ita5_human Integrin alpha-5 ITGA5 FNRA Fibronectin receptor subunit alpha Integrin alpha-F VLA-5 CD49 antigen-like family member E protein protein human Homo sapiens Human MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA antibody hc Antibody hc protein protein mouse Mus musculus Mouse QVHLQQSGAELMKPGASVKISCKATGYTFTSYWIEWVKQRPGHGLEWLGEILPGSGYIHYNEKFKGKATFTTDTSSNTAYMQLSSLTSEDSAVYYCSRALALYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR rgd peptide RGD peptide: RGDNP peptide peptide polypeptide oligopeptide oligopeptide polypeptide synthetic construct synthetic construct RGDNP antibody lc SG/19 Fab fragment (Light chain) protein protein mouse Mus musculus Mouse DIVMTQATPSIPVTPGESVSISCRSNKSLLHSNGNTYLYWFLQRPGQSPRLLIFRMSNLASGVPDRFSGSGSGTAFTLRISRVEAADVGIYFCLQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC finc_human Fibronectin FN1 FN Cold-insoluble globulin protein protein human Homo sapiens Human MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE itga5-itgb1-6 4062211 N/A 4062214 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P05556:p.Thr112His mutation mutation certain certain sequence position certain certain certain sequence position certain false P05556:p.Ser215Thr mutation mutation certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. T112H and S215T are known sequence conflicts annotated in Uniprot (PubMed: 2958481). Stoichiometry: 1.0 N/A 4062215 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 N/A 4062216 unspecified role unspecified role neutral component neutral component purified purified antibody hc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 N/A 4062217 unspecified role unspecified role neutral component neutral component purified purified RGD peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false synthetic construct synthetic construct Stoichiometry: 1.0 N/A 4062218 unspecified role unspecified role neutral component neutral component purified purified antibody lc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 physical association physical association false false false Fig. 1A, Table 1 itga5-itgb1-7 4062211 N/A 4062214 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P05556:p.Thr112His mutation mutation certain certain sequence position certain certain certain sequence position certain false P05556:p.Ser215Thr mutation mutation certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. T112H and S215T are known sequence conflicts annotated in Uniprot (PubMed: 2958481). Stoichiometry: 1.0 N/A 4062215 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 N/A 4062216 unspecified role unspecified role neutral component neutral component purified purified antibody hc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 N/A 4062218 unspecified role unspecified role neutral component neutral component purified purified antibody lc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 physical association physical association false false false Fig. 1, Table 1 fn1-itga5-6 4062212 N/A 4062216 competitor competitor competitor unspecified role unspecified role purified purified antibody hc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 N/A 4062218 competitor competitor competitor unspecified role unspecified role purified purified antibody lc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse Stoichiometry: 1.0 N/A 4062214 unspecified role unspecified role prey prey purified purified ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 4062215 unspecified role unspecified role prey prey purified purified ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 4062219 unspecified role unspecified role bait bait purified purified FNIII 8-11 Fibronectin type III 8-11 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N-terminal Cys tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig. 3 The basic buffer contained Mn2+ but the concentration dependent binding was measured in a Ca2+/Mg2+ buffer. fn1-itga5-7 4062212 N/A 4062214 unspecified role unspecified role prey prey purified purified ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 4062215 unspecified role unspecified role prey prey purified purified ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P08648:p.Asp195Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. Stoichiometry: 1.0 N/A 4062219 unspecified role unspecified role bait bait purified purified FNIII 8-11 Fibronectin type III 8-11 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N-terminal Cys tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P02751:p.Arg1501Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Figs. 3, 7B fn1-itga5-5 4062213 N/A 4062214 unspecified role unspecified role bait bait purified purified ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 4062219 unspecified role unspecified role prey prey purified purified FNIII 8-11 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N-terminal Cys tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P02751:p.[Arg1496Ala;Pro1498Ala;Arg1501Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) The 3 mutations (R1496A, P1498A and R1501A) were present simultaneously in the protein. There is no experiment about their individual effect. N/A 4062215 unspecified role unspecified role bait bait purified purified ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P08648:p.Glu122Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08648:p.Glu165Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08648:p.Asp195Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction false false false Fig. 7A