IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ papac_milicevic-2012-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Circulation research 2012 Only protein-protein interactions imex curation imex curation papac_milicevic-2012-6 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. Cells treated with human IFNa prior to assay. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Circulation research 2012 Only protein-protein interactions imex curation imex curation papac_milicevic-2012-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at A library generated with cDNA obtained from lipopolysaccharide (LPS)/tumor necrosis factor (TNF)a-activated human uterine microvascular endothelial cells. Circulation research 2012 Only protein-protein interactions imex curation imex curation papac_milicevic-2012-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at A library generated with cDNA obtained from lipopolysaccharide (LPS)/tumor necrosis factor (TNF)a–activated human uterine microvascular endothelial cells. Circulation research 2012 Only protein-protein interactions imex curation imex curation papac_milicevic-2012-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Circulation research 2012 Only protein-protein interactions imex curation imex curation papac_milicevic-2012-5 human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Circulation research 2012 Only protein-protein interactions imex curation imex curation p40305-2 Interferon alpha-inducible protein 27, mitochondrial Interferon alpha-induced 11.5 kDa protein Interferon-stimulated gene 12a protein ISG12 ISG12A IFI27 protein protein human Homo sapiens Human MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY nr4a1_human Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor HMR Early response protein NAK1 Orphan nuclear receptor TR3 ST-59 GFRP1 HMR NAK1 NR4A1 Nuclear hormone receptor NUR/77 Testicular receptor 3 protein protein human Homo sapiens Human MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF xpo1_human Exportin-1 CRM1 XPO1 Chromosome region maintenance 1 protein homolog protein protein human Homo sapiens Human MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD lmna_human Prelamin-A/C LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM irf1_human Interferon regulatory factor 1 IRF1 protein protein human Homo sapiens Human MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP ifi27_human_gene Interferon alpha-inducible protein 27, mitochondrial IFI27 gene gene human Homo sapiens Human irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES irf4_human Interferon regulatory factor 4 Lymphocyte-specific interferon regulatory factor NF-EM5 Multiple myeloma oncogene 1 IRF4 MUM1 protein protein human Homo sapiens Human MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE nr4a1-ifi27-3 4106483 N/A 4106489 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106490 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 1A, row 2, lane 2 nr4a1-ifi27-4 4106483 N/A 4106489 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106490 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 1A, row 2, lane 1 nr4a1-ifi27-5 4106483 N/A 4106489 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106490 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false 1A, row 4, lane 2 ifi27-nr4a1-1 4106483 N/A 4106489 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106490 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 1A, row 4, lane 1 nr4a1-xpo1-1 4106483 N/A 4106491 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4106490 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 2E, lanes 1+2 ISG12 silencing nr4a1-xpo1-2 4106483 N/A 4106491 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4106490 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 2E, lanes 5+6 ISG12 silencing lmna-ifi27-1 4106483 N/A 4106489 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106492 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. figure 2F irf1-ifi27-1 4106484 N/A 4106493 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4106494 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 14:94110491 to 14:94110740 physical association physical association false false false 3E irf3-ifi27-1 4106484 N/A 4106494 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 14:94110491 to 14:94110740 N/A 4106495 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 3E irf4-ifi27-1 4106484 N/A 4106494 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 14:94110491 to 14:94110740 N/A 4106496 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 3E nr4a1-ifi27-1 4106485 N/A 4106489 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4106490 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false none nr4a1-ifi27-2 4106486 N/A 4106489 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4106490 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supp. figure 1A nr4a1-ifi27-6 4106487 N/A 4106489 predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106490 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1B ifi27-nr4a1-2 4106488 N/A 4106489 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4106490 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2C