MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint dastidar-2012-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation dastidar-2012-1 rat-cgnp Rattus norvegicus brain-granule_neuron_precursor Cerebellum granule neuron precursor (CGNP) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation dastidar-2012-2 mouse-ht22 mouse HT22 immortalized hippocampal cell line Mouse ht22 HT22 immortalized mouse hippocampal cell line fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation dastidar-2012-4 rat-cgnp Rattus norvegicus brain-granule_neuron_precursor Cerebellum granule neuron precursor (CGNP) fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation foxg1_mouse Forkhead box protein G1 Foxg1 Fkhl1 Foxg1b Hfhbf1 Brain factor 1 Forkhead-related protein FKHL1 protein protein mouse Mus musculus Mouse MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH q9z2d6-1 Methyl-CpG-binding protein 2 Mecp2 Beta protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS q9z2d6-2 Methyl-CpG-binding protein 2 Mecp2 Alpha protein protein mouse Mus musculus Mouse MAAAAATAAAAAAPSGGGGGGEEERLEEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS foxg1-mecp2-2 3976145 N/A 3976149 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3976150 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false f6c mecp2-foxg1-1 3976145 N/A 3976149 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3976151 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false f6c mecp2-foxg1-2 3976145 N/A 3976149 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3976151 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false f6d f8b foxg1-3 3976145 N/A 3976149 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3976150 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9Z2D6-1:p.Met1_Arg9del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false f6d f8b foxg1-mecp2-4 3976145 N/A 3976149 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3976150 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding range binding range required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f7b f7c foxg1-mecp2-5 3976146 N/A 3976149 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3976152 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f6a foxg1-mecp2-3 3976147 N/A 3976149 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3976150 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false f6e foxg1-mecp2-1 3976148 N/A 3976149 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3976152 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f6b