UniProt UniProt http://www.uniprot.org nabokina-2011-6 ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nabokina SM., Senthilkumar SR., Said HM. hmsaid@uci.edu Human intestinal cDNA American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation nabokina-2011-7 ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nabokina SM., Senthilkumar SR., Said HM. hmsaid@uci.edu American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation nabokina-2011-8 human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nabokina SM., Senthilkumar SR., Said HM. hmsaid@uci.edu American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation nabokina-2011-9 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nabokina SM., Senthilkumar SR., Said HM. hmsaid@uci.edu American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation nabokina-2011-10 human-hutu80 Human duodenum adenocarcinoma HuTu80 hutu80 Human duodenum adenocarcinoma HuTu80 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Nabokina SM., Senthilkumar SR., Said HM. hmsaid@uci.edu American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation s19a2_human Thiamine transporter 1 SLC19A2 THT1 TRMA Solute carrier family 19 member 2 Thiamine carrier 1 protein protein human Homo sapiens Human MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGPDKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQGLLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILVSVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSVWWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWSTWGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERYALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMKKCRKLEDPQSSSQVTTS tsn1_human Tetraspanin-1 TSPAN1 Tetraspan NET-1 Tetraspanin TM4-C protein protein human Homo sapiens Human MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ slc19a2-tspan1-1 3987284 N/A 3987289 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3987290 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false slc19a2-tspan1-2 3987285 N/A 3987289 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3987290 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1 slc19a2-tspan1-3 3987286 N/A 3987289 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3987290 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 2 tspan1-slc19a2-1 3987287 N/A 3987289 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma N/A 3987290 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3 slc19a2-tspan1-4 3987288 N/A 3987289 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3987290 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 4