UniProt UniProt http://www.uniprot.org grote-2010-7 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-6 in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. Complexes were purified on anti-FLAG-M2-agarose then cross-linked using Sulfo-MBS (m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester) Proteins were then separated by SDS-gel electrophoresis. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-8 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-1 human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-5 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. Complexes were purified on anti-FLAG-M2-agarose then co-sedimented on a linear 5-to-20% glycerol gradient reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-9 in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint sequence tag sequence tag identification sequence tag Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. Purified complexes were incubated with the protease subtilisin and the proteolysed components were then fractionated via gel filtration and analyzed. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-3 in vitro In vitro comigration in sds comigration in sds page comigration in sds experimental particp experimental participant identification experimental particp Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. Complexes were purified on anti-FLAG-M2-agarose then labelled with [14C]iodoacetamide.Gels were stained with Sypro-Ruby and both fluorescence intensity and radioactivity of the proteins were monitored. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-4 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. Complexes were purified on anti-FLAG-M2-agarose then co-sedimented in in phosphate-buffered saline reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation grote-2010-10 human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Grote M., Wolf E., Will CL., Lemm I., Agafonov DE., Schomburg A., Fischle W., Urlaub H., Lührmann R. At least one protein is tagged, as the complex is affinity purified, but it is not clear which. Affinity-purified human Prp19/CDC5L complexes. reinhard.luehrmann@mpi-bpc.mpg.de Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation spf27_human Pre-mRNA-splicing factor SPF27 Spliceosome-associated protein SPF 27 Breast carcinoma-amplified sequence 2 DNA amplified in mammary carcinoma 1 protein BCAS2 DAM1 protein protein human Homo sapiens Human MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF cdc5l_human Cell division cycle 5-like protein CDC5L Pombe cdc5-related protein KIAA0432 PCDC5RP protein protein human Homo sapiens Human MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF prp19_human Pre-mRNA-processing factor 19 PRPF19 PRP19/PSO4 homolog Nuclear matrix protein 200 Senescence evasion factor NMP200 PRP19 SNEV RING-type E3 ubiquitin transferase PRP19 protein protein human Homo sapiens Human MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL ctbl1_human Beta-catenin-like protein 1 Nuclear-associated protein Testis development protein NYD-SP19 PP8304 CTNNBL1 C20orf33 protein protein human Homo sapiens Human MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADDDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISRSSALKVLDHAMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLENF cwc15_human Spliceosome-associated protein CWC15 homolog CWC15 C11orf5 AD-002 HSPC148 protein protein human Homo sapiens Human MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK plrg1_human Pleiotropic regulator 1 PLRG1 protein protein human Homo sapiens Human MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKRKRF hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD cdc5l-bcas2-1 4056342 N/A 4056351 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056352 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B cdc5l-bcas2-2 4056342 N/A 4056352 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056351 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B prpf19-bcas2-2 4056342 N/A 4056353 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056351 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B bcas2-prpf19-1 4056342 N/A 4056351 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056353 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B cdc5l-prpf19-1 4056342 N/A 4056353 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056352 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B prpf19-cdc5l-1 4056342 N/A 4056352 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056353 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B cwc15-ctnnbl1-2 4056342 N/A 4056354 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056355 unspecified role unspecified role prey prey purified purified n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B Interaction observed in presence of 150mM salt but not at 300mM. ctnnbl1-cdc5l-1 4056342 N/A 4056354 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056352 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B Interaction observed in presence of 150mM salt but not at 300mM. cdc5l-cdc5l-1 4056342 N/A 4056352 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056352 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig.6B Interaction observed in presence of 150mM salt but not at 300mM. plrg1-cdc5l-1 4056342 N/A 4056352 unspecified role unspecified role prey prey purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056356 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.6B Interaction observed in presence of 150mM salt but not at 300mM. bcas2-plrg1-1 4056343 N/A 4056351 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056356 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH direct interaction direct interaction false false false Fig.5 bcas2-cdc5l-7 4056343 N/A 4056351 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056352 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH direct interaction direct interaction false false false Fig.5 plrg1-prpf19-1 4056343 N/A 4056353 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056356 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH direct interaction direct interaction false false false Fig.5 ctnnbl1-prpf19-1 4056343 N/A 4056355 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056354 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH direct interaction direct interaction false false false Fig.5 bcas2-prpf19-2 4056344 N/A 4056353 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056351 unspecified role unspecified role bait bait purified purified region strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.6C bcas2-cdc5l-8 4056344 N/A 4056352 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056351 unspecified role unspecified role bait bait purified purified region strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.6C cwc15-ctnnbl1-3 4056344 N/A 4056354 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056355 unspecified role unspecified role bait bait purified purified region strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.6C prpf19-cdc5l-2 4056344 N/A 4056352 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 4056353 unspecified role unspecified role bait bait purified purified region strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig.6C cwc15-bcas2-1 4056345 N/A 4056352 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056357 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056354 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056356 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056353 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056351 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056355 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig. 2 bcas2-cdc5l-2 4056345 N/A 4056352 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056357 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056354 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056356 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056353 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056355 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4056351 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig. 2 bcas2-cdc5l-6 4056346 N/A 4056352 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056356 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056353 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 4.0 N/A 4056351 unspecified role unspecified role neutral component neutral component cell lysate cell lysate human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 physical association physical association false false false Figs. 4,Supp. Fig. 2. The proteins comigrate after treatment with 1.2 M NaCl, 0.4 M NaSCN or 0.1 mg/ml heparin. ctnnbl1-cwc15-1 4056346 N/A 4056355 unspecified role unspecified role neutral component neutral component purified purified n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056354 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH direct interaction direct interaction false false false Fig.4B, Supp. Fig. 2 Proteins comigrate after treatment with 0.1 mg/ml heparin or 300 mM NaCl but not after treatment with 1.2M NaCl or a 0.4 M concentration of the chaotropic salt NaSCN bcas2-cdc5l-10 4056347 N/A 4056356 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056352 edman degradation edman degradation unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056353 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056351 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Figs. 8A, 8B. Supp. figs 5+6. bcas2-cdc5l-11 4056347 N/A 4056357 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056352 edman degradation edman degradation unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056354 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Figs. 8A, 8B. Supp. figs 5+6. bcas2-cdc5l-4 4056348 N/A 4056352 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056357 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056354 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056356 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056353 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 4.0 N/A 4056355 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056351 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 physical association physical association false false false Figs. 3A-C bcas2-cdc5l-5 4056349 N/A 4056352 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056356 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056353 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 4.0 N/A 4056351 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056357 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056355 unspecified role unspecified role neutral component neutral component purified purified n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 N/A 4056354 unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH Stoichiometry: 1.0 physical association physical association false false false Figs. 3D, 3E bcas2-cdc5l-12 4056350 N/A 4056352 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056357 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056354 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056356 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056353 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056351 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH N/A 4056355 weight by staining molecular weight estimation by staining weight by staining weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role neutral component neutral component purified purified human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH physical association physical association false false false Fig. 9