DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stanley-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stanley RE., Blaha G., Grodzicki RL., Strickler MD., Steitz TA. thomas.steitz@yale.edu Nature structural & molecular biology 2010 imex curation Only protein-protein interactions imex curation rs7_thet8 30S ribosomal protein S7 rpsG rps7 TTHA1696 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW mint One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA rl36_thet8 50S ribosomal protein L36 rpmJ Ribosomal protein B TTHA1668 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG rl35_thet8 50S ribosomal protein L35 rpmI TTHA0552 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPYE rl34_thet8 50S ribosomal protein L34 rpmH rpl34 TTHA0446 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR rl33_thet8 50S ribosomal protein L33 rpmG rpl33 TTHA0250 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI rl32_thet8 50S ribosomal protein L32 rpmF rpl32 TTHA0418 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV rl31_thet8 50S ribosomal protein L31 rpmE TTHA1073 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR rl30_thet8 50S ribosomal protein L30 rpmD TTHA1674 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE rl29_thet8 50S ribosomal protein L29 rpmC TTHA1684 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA rl28_thet8 50S ribosomal protein L28 rpmB TTHA0042 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL rl27_thet8 50S ribosomal protein L27 rpmA TTHA1782 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA rl25_thet8 50S ribosomal protein L25 rplY rpl25 rptL5 TTHA1589 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAEVAEPEVIKKGKEEEEE rl24_thet8 50S ribosomal protein L24 rplX TTHA1681 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE rl23_thet8 50S ribosomal protein L23 rplW TTHA1690 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI rl22_thet8 50S ribosomal protein L22 rplV TTHA1687 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK rl21_thet8 50S ribosomal protein L21 rplU TTHA1783 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIRG rl20_thet8 50S ribosomal protein L20 rplT TTHA0553 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG rl19_thet8 50S ribosomal protein L19 rplS TTHA1031 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADRKRIDQDRAAERAAKEEAQKAQEPKASQE rl18_thet8 50S ribosomal protein L18 rplR TL24 TTHA1676 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF rl17_thet8 50S ribosomal protein L17 rplQ rpl17 TTHA1663 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLAERRRGDGAPLALVELVE rl16_thet8 50S ribosomal protein L16 rplP TTHA1685 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ rl15_thet8 50S ribosomal protein L15 rplO TTHA1673 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA rl14_thet8 50S ribosomal protein L14 TTHA1682 rplN protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL rl13_thet8 50S ribosomal protein L13 rplM TTHA1465 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV rl9_thet8 50S ribosomal protein L9 rplI TTHA0242 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEARIRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEALSRQHGVTIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVAQE rl6_theaq 50S ribosomal protein L6 rplF BVI061214_01035 protein protein theaq Thermus aquaticus MSRIGRLPIPVPKGVQVQVSPGLVKVKGPKGELSVPVSPELKVVVEENVVRVERPSDERRHRSLHGLTRTLIANAVKGVSEGYVKELLIKGIGYRARLVGRSIELTVGFSHPVVVEPPEGITFEVPEPTRIRVLGIDKQKVGQVAADIRAIKKPSAYHEKGIYYADEPVRLKPGKAGAKK rl5_thet8 50S ribosomal protein L5 rplE TTHA1680 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK rl4_thet8 50S ribosomal protein L4 L1e TTHA1691 rplD protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA rl3_thet8 50S ribosomal protein L3 rplC TTHA1692 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRETKKAAK rl2_thet8 50S ribosomal protein L2 rplB TTHA1689 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK rl1_thet8 50S ribosomal protein L1 rplA TTHA0246 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS rshx_thet8 30S ribosomal protein Thx rpsU S31 TTHA1396 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGKGDRRTRRGKIWRGTYGKYRPRKKK rs20_thet8 30S ribosomal protein S20 rpsT rps20 TTHA1397 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA rs19_thet8 30S ribosomal protein S19 rpsS TTHA1688 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK rs18_thet8 30S ribosomal protein S18 rpsR TTHA0243 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK rs17_thet8 30S ribosomal protein S17 rpsQ TTHA1683 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA rs16_thet8 30S ribosomal protein S16 rpsP TTHA1035 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA rs15_thet8 30S ribosomal protein S15 rpsO TTHA1138 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG rs14z_theaq 30S ribosomal protein S14 type Z rpsZ rpsN BVI061214_01033 protein protein theaq Thermus aquaticus MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRYFGLCRICLRELAHKGQLPGVKKASW rs13_thet8 30S ribosomal protein S13 rpsM rps13 TTHA1667 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK rs12_thet8 30S ribosomal protein S12 rpsL TTHA1697 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK rs11_thet8 30S ribosomal protein S11 rpsK rps11 TTHA1666 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS rs10_thet8 30S ribosomal protein S10 TTHA1693 rpsJ protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR rs9_thet8 30S ribosomal protein S9 rpsI rps9 TTHA1464 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR rs8_thet8 30S ribosomal protein S8 rpsH TTHA1678 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA rs5_thet8 30S ribosomal protein S5 rpsE TTHA1675 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG rs4_thet8 30S ribosomal protein S4 rpsD rps4 TTHA1665 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR rs3_thet8 30S ribosomal protein S3 rpsC rps3 TTHA1686 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE rs2_thet8 30S ribosomal protein S2 rpsB rps2 TTHA0861 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA rpla-rplb-10 4047225 N/A 4047226 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047227 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047228 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047229 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047230 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047231 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047232 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047233 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047234 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047235 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047236 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047237 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047238 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047239 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047240 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047241 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047242 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047243 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047244 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047245 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047246 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047247 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047248 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047249 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047250 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047251 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047252 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047253 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047254 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047255 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047256 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047257 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047258 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047259 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047260 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047261 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047262 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047263 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047264 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047265 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047266 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047267 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047268 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047269 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047270 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047271 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047272 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047273 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047274 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 N/A 4047275 unspecified role unspecified role neutral component neutral component purified purified thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Stoichiometry: 1.0 physical association physical association false false false Table 1