UniProt UniProt http://www.uniprot.org somvanshi-2009-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret anti-tag immunocytochemistry anti-tag immunocytochemistry Somvanshi RK., Billova S., Kharmate G., Rajput PS., Kumar U. Homodimerizarion was assessed through the use of anti-HA antibodies conjugated with either fluorescein (donor) or rhodamine (acceptor) for microscopic Pb-FRET analysis. ujkumar@interchange.ubc.ca Cellular signalling 2009 Only protein-protein interactions imex curation imex curation somvanshi-2009-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Somvanshi RK., Billova S., Kharmate G., Rajput PS., Kumar U. ujkumar@interchange.ubc.ca Cellular signalling 2009 Only protein-protein interactions imex curation imex curation somvanshi-2009-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Somvanshi RK., Billova S., Kharmate G., Rajput PS., Kumar U. ujkumar@interchange.ubc.ca Cellular signalling 2009 Only protein-protein interactions imex curation imex curation ssr4_human Somatostatin receptor type 4 SSTR4 protein protein human Homo sapiens Human MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLVGLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF ssr5_human Somatostatin receptor type 5 SSTR5 protein protein human Homo sapiens Human MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL sstr4-sstr4-1 4078324 N/A 4078327 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 4078327 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 1 Somatostatin-14 (PRO_0000033088) sstr4-sstr5-1 4078324 N/A 4078328 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078327 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figs. 5B-E, 6, Table 2 Somatostatin-14 (PRO_0000033088) L-803087 (CHEBI:177197) L-817818 (CHEBI:177199) sstr4-sstr5-3 4078325 N/A 4078328 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078327 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig.7C Somatostatin-14 (PRO_0000033088) L-803087 (CHEBI:177197) L-817818 (CHEBI:177199) sstr4-sstr5-4 4078326 N/A 4078328 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078327 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig.5A, 9 Somatostatin-14 (PRO_0000033088) L-803087 (CHEBI:177197) L-817818 (CHEBI:177199) Colocalisation of SSTR5 and SSTR4 decreased and concomitantly increased intracellularly upon treatment with SST-14.The SSTR4/SSTR5 heterodimers internalized upon activation of hSSTR4 alone whereas upon treatment with the SSTR5 specific agonist (L-817818), a reduction in internalization of SSTR5 was observed.