UniProt UniProt http://www.uniprot.org grant-2008-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Molecular endocrinology (Baltimore, Md.) 2008 Only protein-protein interactions imex curation imex curation Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. grant-2008-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret anti-tag immunocytochemistry anti-tag immunocytochemistry Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. To assess heterodimer formation, an anti-HA antibody conjugated to fluorescein was used as the fluorescence donor and an anti-c-Myc antibody conjugated to rhodamine as the acceptor. For homodimer formation, anti-Myc monoclonal antibodies conjugated to fluorescein acted as fluorescence donor or to rhodamine as the acceptor. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Molecular endocrinology (Baltimore, Md.) 2008 Only protein-protein interactions imex curation imex curation Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. grant-2008-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Molecular endocrinology (Baltimore, Md.) 2008 Only protein-protein interactions imex curation imex curation Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. ssr2_human Somatostatin receptor type 2 SSTR2 SRIF-1 protein protein human Homo sapiens Human MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI ssr5_human Somatostatin receptor type 5 SSTR5 protein protein human Homo sapiens Human MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL arrb2_human Beta-arrestin-2 Arrestin beta-2 ARRB2 ARB2 ARR2 Non-visual arrestin-3 protein protein human Homo sapiens Human MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC sstr2-sstr5-1 4078238 N/A 4078241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078242 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig.1B L-779,976 (CHEBI:176977) sstr5-sstr2-1 4078238 N/A 4078241 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078242 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp. Fig.1 L-779,976 (CHEBI:176977) arrb2-sstr2-1 4078238 N/A 4078241 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078243 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig.4B L-779,976 (CHEBI:176977) Somatostatin-14 (PRO_0000033088) SSRT5 (P35346) sstr2-sstr5-2 4078239 N/A 4078241 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078242 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig.1D, 2A L-779,976 (CHEBI:176977) sstr5-1 4078239 N/A 4078242 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078242 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig.1E Somatostatin-14 (PRO_0000033088) sstr2-arrb2-1 4078240 N/A 4078241 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078243 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig.4A L-779,976 (CHEBI:176977) Somatostatin-14 (PRO_0000033088) sstr2-sstr5-3 4078240 N/A 4078241 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078242 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig.5 Somatostatin-14 (PRO_0000033088)