MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zatyka-2008-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zatyka M., Ricketts C., da Silva Xavier G., Minton J., Fenton S., Hofmann-Thiel S., Rutter GA., Barrett TG. Diabetes - Interactions investigated in the context of Diabetes t.g.barrett@bham.ac.uk Human molecular genetics 2008 Only protein-protein interactions imex curation imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Brain Disease - Neurological Diseases & Disorders zatyka-2008-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zatyka M., Ricketts C., da Silva Xavier G., Minton J., Fenton S., Hofmann-Thiel S., Rutter GA., Barrett TG. Diabetes - Interactions investigated in the context of Diabetes t.g.barrett@bham.ac.uk human brain cDNA library Human molecular genetics 2008 Only protein-protein interactions imex curation imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Brain Disease - Neurological Diseases & Disorders zatyka-2008-3 human-jeg3 Homo sapiens choriocarcinoma JEG3 jeg3 Human choriocarcinoma JEG3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zatyka M., Ricketts C., da Silva Xavier G., Minton J., Fenton S., Hofmann-Thiel S., Rutter GA., Barrett TG. Diabetes - Interactions investigated in the context of Diabetes t.g.barrett@bham.ac.uk Human molecular genetics 2008 Only protein-protein interactions imex curation imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Brain Disease - Neurological Diseases & Disorders zatyka-2008-4 human-sk-n-as human sk-n-as neuroblatoma cell line sk-n-as sk-n-as neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zatyka M., Ricketts C., da Silva Xavier G., Minton J., Fenton S., Hofmann-Thiel S., Rutter GA., Barrett TG. Diabetes - Interactions investigated in the context of Diabetes t.g.barrett@bham.ac.uk Human molecular genetics 2008 Only protein-protein interactions imex curation imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Brain Disease - Neurological Diseases & Disorders at1b1_human Sodium/potassium-transporting ATPase subunit beta-1 Sodium/potassium-dependent ATPase subunit beta-1 ATP1B1 ATP1B protein protein human Homo sapiens Human MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS wfs1_human Wolframin WFS1 protein protein human Homo sapiens Human MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEELNSCTAVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQKQRRMLERLVSSESKNYIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPEDLPLRLKVVKYPLHAIMEIKEYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIFYLSFISMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFPIASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPYLKVLGQTFITVPVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLESTGLGLLRASIGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVTVAVCSVPLLLRWWTKASFSVVGMVKSLTRSSMVKLILVWLTAIVLFCWFYVYRSEGMKVYNSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTDIDNSAESAINMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA wfs1-atp1b1-1 4058953 N/A 4058957 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4058958 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2B-D wfs1-atp1b1-2 4058953 N/A 4058957 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4058958 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1B wfs1-atp1b1-4 4058953 N/A 4058957 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4058958 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1A wsf1-atpase-1 4058954 N/A 4058957 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058958 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false NA we undertook a yeast two-hybrid screen using the WFS1 Cterminal domain as bait in a human cDNA library. Using this and complementary approaches we identify the Na+/K+ATPase beta-1 subunit as a novel interacting partner wfs1-atp1b1-3 4058955 N/A 4058958 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4058957 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3A atp1b1-wfs1-1 4058956 N/A 4058958 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4058957 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3B