UniProt UniProt http://www.uniprot.org zito-2005-1 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zito E., Fraldi A., Pepe S., Annunziata I., Kobinger G., Di Natale P., Ballabio A., Cosma MP. cosma@tigem.it EMBO reports 2005 Only protein-protein interactions imex curation imex curation zito-2005-3 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel anti tag western anti tag western blot anti tag western Zito E., Fraldi A., Pepe S., Annunziata I., Kobinger G., Di Natale P., Ballabio A., Cosma MP. Cells were treated with the alkylating reagent N-ethylmaleimide (NEM), which acts on free thiols and prevents the reduction of existing disulphide bonds. cosma@tigem.it EMBO reports 2005 Only protein-protein interactions imex curation imex curation zito-2005-2 human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zito E., Fraldi A., Pepe S., Annunziata I., Kobinger G., Di Natale P., Ballabio A., Cosma MP. cosma@tigem.it EMBO reports 2005 Only protein-protein interactions imex curation imex curation zito-2005-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Zito E., Fraldi A., Pepe S., Annunziata I., Kobinger G., Di Natale P., Ballabio A., Cosma MP. cosma@tigem.it EMBO reports 2005 Only protein-protein interactions imex curation imex curation zito-2005-5 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zito E., Fraldi A., Pepe S., Annunziata I., Kobinger G., Di Natale P., Ballabio A., Cosma MP. cosma@tigem.it EMBO reports 2005 Only protein-protein interactions imex curation imex curation sumf2_human Inactive C-alpha-formylglycine-generating enzyme 2 SUMF2 Sulfatase-modifying factor 2 PSEC0171 UNQ1968/PRO4500 Paralog of formylglycine-generating enzyme protein protein human Homo sapiens Human MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGDGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAADAGRPPGEL sumf1_human Formylglycine-generating enzyme C-alpha-formylglycine-generating enzyme 1 SUMF1 UNQ3037/PRO9852 PSEC0152 Sulfatase-modifying factor 1 protein protein human Homo sapiens Human MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD ids_human Iduronate 2-sulfatase SIDS Alpha-L-iduronate sulfate sulfatase IDS protein protein human Homo sapiens Human MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPPRCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQLLMP sphm_human N-sulphoglucosamine sulphohydrolase SGSH HSS Sulfoglucosamine sulfamidase Sulphamidase protein protein human Homo sapiens Human MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNEL sumf1_chlae_protein Formylglycine-generating enzyme protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to Q8NBK3 sumf2_chlae_protein Inactive C-alpha-formylglycine-generating enzyme 2 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to Q8NBJ7 sumf2-sumf1-1 4070875 N/A 4070880 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false fig 2A sumf2-sumf2-1 4070875 N/A 4070880 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 2A sumf1-sumf1-1 4070875 N/A 4070881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 2A sumf1-sumf2-1 4070875 N/A 4070881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2A sumf1-ids-1 4070875 N/A 4070882 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig 2C ids-sumf2-1 4070875 N/A 4070882 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 2C sumf2-sgsh-1 4070875 N/A 4070883 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4070880 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 2C sumf1-sgsh-1 4070875 N/A 4070881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4070883 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig 2C sumf1-sgsh-2 4070875 N/A 4070881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4070883 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 2C sumf2-sumf2-3 4070875 N/A 4070880 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8NBJ7:p.[Cys156Ala;Cys290Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3B, Supp. Fig 3A sumf1-sumf2-6 4070875 N/A 4070881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8NBJ7:p.[Cys156Ala;Cys290Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3B, Supp. Fig. 3A sumf2-sumf1-2 4070875 N/A 4070880 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp.fig 3A sumf1-sumf1-3 4070875 N/A 4070881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp. 3A sumf1-sumf2-3 4070876 N/A 4070880 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 3A 1,4-dithiothreitol (CHEBI:18320) sumf1-sumf2-4 4070876 N/A 4070881 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070880 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 3A 1,4-dithiothreitol (CHEBI:18320) sumf1-sumf1-2 4070876 N/A 4070881 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 3A 1,4-dithiothreitol (CHEBI:18320) sumf1-sumf2-2 4070877 N/A 4070880 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070881 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 2B sumf1-sumf2-5 4070878 N/A 4070880 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4070881 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Supp. Fig 2B sumf1_chlae_protein-sumf2_chlae_protein-1 4070879 N/A 4070884 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4070885 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Fig. 3B