UniProt UniProt http://www.uniprot.org grant-2004-1 crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret immunocytochemistry immunocytochemistry Grant M., Patel RC., Kumar U. pbFRET microscopy was performed on cells by using a primary antibody followed by a secondary antibody conjugated with fluorescein (donor) to SSTR1 and an anti-HA monoclonal antibody conjugated with rhodamine (acceptor) to SSTR5. ujendra.kumar@muhc.mcgill.ca The Journal of biological chemistry 2004 Only protein-protein interactions imex curation imex curation grant-2004-2 crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Grant M., Patel RC., Kumar U. ujendra.kumar@muhc.mcgill.ca The Journal of biological chemistry 2004 Only protein-protein interactions imex curation imex curation grant-2004-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grant M., Patel RC., Kumar U. ujendra.kumar@muhc.mcgill.ca The Journal of biological chemistry 2004 Only protein-protein interactions imex curation imex curation ssr5_human Somatostatin receptor type 5 SSTR5 protein protein human Homo sapiens Human MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL ssr1_human Somatostatin receptor type 1 SRIF-2 SSTR1 protein protein human Homo sapiens Human MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL p61278-pro_0000033088 Somatostatin-14 SST Growth hormone release-inhibiting factor protein protein human Homo sapiens Human AGCKNFFWKTFTSC 103 116 sstr1-sstr5-1 4078279 N/A 4078282 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078283 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction false false false Figs. 1B, 1C, 2 Somatostatin-14 (PRO_0000033088) Somatostatin-28 (PRO_0000033087,CHEBI:80249) SMS 201-995 (CHEBI:177082) sst-sst-3 4078279 N/A 4078282 unspecified role unspecified role neutral component neutral component N/A 4078282 unspecified role unspecified role neutral component neutral component N/A 4078284 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept texas red labelled region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 4078284 unspecified role unspecified role fluorescence donor fluorescence donor trp-8 fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 6 sstr1-sstr5-2 4078280 N/A 4078282 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078283 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed colocalization colocalization false false false Fig. 1A sstr1-sstr5-3 4078281 N/A 4078282 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4078283 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3 Somatostatin-14 (PRO_0000033088)