UniProt UniProt http://www.uniprot.org davies-1998-1 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Davies AA., West SC. stephen.west@crick.ac.uk Current biology : CB 1998 Only protein-protein interactions imex curation imex curation ruvb_ecoli Holliday junction ATP-dependent DNA helicase RuvB ruvB b1860 JW1849 protein protein ecoli Escherichia coli (strain K12) MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP ruva_ecoli Holliday junction ATP-dependent DNA helicase RuvA ruvA b1861 JW1850 protein protein ecoli Escherichia coli (strain K12) MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRMVSKIARPDASSETLIREALRAAL ruvc_ecoli Crossover junction endodeoxyribonuclease RuvC ruvC b1863 JW1852 Holliday junction nuclease RuvC Holliday junction resolvase RuvC protein protein ecoli Escherichia coli (strain K12) MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR ruva-ruvb-3 3651610 N/A 3651611 unspecified role unspecified role prey prey purified purified N/A 3651612 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false Fig 1A Interaction observed in the presence and absence of duplex DNA or Holliday junction DNA ruva-ruvb-4 3651610 N/A 3651611 unspecified role unspecified role bait bait purified purified N/A 3651612 unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false Fig 1B Interaction observed in the presence and absence of duplex DNA or Holliday junction DNA ruva-ruvc-1 3651610 N/A 3651613 unspecified role unspecified role prey prey purified purified N/A 3651612 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false Fig 1A In the presence of Holliday junction DNA, RuvA formed a complex with RuvC that was immunoprecipitated with the anti-RuvA or the anti-RuvC. Interaction only observed in the presence of Holliday junction DNA, but not duplex DNA. ruva-ruvc-2 3651610 N/A 3651613 unspecified role unspecified role bait bait purified purified N/A 3651612 unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false Fig 1C In the presence of Holliday junction DNA, RuvA formed a complex with RuvC that was immunoprecipitated with the anti-RuvA or the anti-RuvC. Interaction only observed in the presence of Holliday junction DNA but not duplex DNA. ruva-ruvb-5 3651610 N/A 3651611 unspecified role unspecified role prey prey purified purified N/A 3651613 unspecified role unspecified role prey prey purified purified N/A 3651612 unspecified role unspecified role bait bait purified purified association association false false false Fig 1A In the presence of Holliday junction DNA, RuvA formed a complex with RuvC that was immunoprecipitated with the anti-RuvA or the anti-RuvC. Interaction only observed in the presence of Holliday junction DNA but not duplex DNA. ruvb-ruva-2 3651610 N/A 3651611 unspecified role unspecified role bait bait purified purified N/A 3651613 unspecified role unspecified role prey prey purified purified N/A 3651612 unspecified role unspecified role prey prey purified purified association association false false false Fig 1B Interaction only observed in the presence of Holliday junction DNA but not duplex DNA. ruvc-ruva-1 3651610 N/A 3651611 unspecified role unspecified role prey prey purified purified N/A 3651613 unspecified role unspecified role bait bait purified purified N/A 3651612 unspecified role unspecified role prey prey purified purified association association false false false Fig 1C Interaction only observed in the presence of Holliday junction DNA but not duplex DNA.