DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ aalto-1997-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Aalto MK., Jäntti J., Ostling J., Keränen S., Ronne H. Ronne@ bmc.uu.se Proceedings of the National Academy of Sciences of the United States of America 1997 Only protein-protein interactions imex curation imex curation aalto-1997-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Aalto MK., Jäntti J., Ostling J., Keränen S., Ronne H. Ronne@ bmc.uu.se Proceedings of the National Academy of Sciences of the United States of America 1997 Only protein-protein interactions imex curation imex curation mso1_yeast Protein MSO1 MSO1 N3457 YNR049C protein protein yeast Saccharomyces cerevisiae Baker's yeast MMSQVSHSQEGSGRFWNKFKSSTKSLSTSLAHLSIKAEKDGDTVNTTLVHKGLVKFYENQHPFQGFPGWLGEKEDLPNERKILDTQVKHDMKKQNSRHFSPSFSNRRKASSEDPMGTPSSNGNTPEYTPASKSFQDIYNNHTSSSSATPRRASSRPTRPSAGQEFRASLGRSKTSNSFNTSSTPTPPPDASSGVMAMKDRLKRRNNDYGF sec1_yeast Protein transport protein SEC1 YD8358.18C YDR164C SEC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLIELQRNYLIGVLNQIETKNNLKFLIIDKTVETILSYLFLTPQELLNNVTSVDLIDSPTRKGQSSIEAIYILEPTKYNINCIDADFMVRPPKYRRCHIRFLPGLTNPIFQFFQSKRYIAQNLESFKPIELGFFVKESQFFETLQMEHSLQVFFNNNCKALIPTNVRKIVGSLVSLCVITGEYPIVRYSVSNPVEEEDARNGNAVVNANSLTRSIANAFQIAIDTYARNNPDFPPQNTERPRSILIITDRTLDPFAPILHDFSYQAMAYDLVANVDTQKDIYHYSAENEAGEQEEKVSKLVDLYDPDWIDLKHQHIMDANEYIQGRIKELIAKNPLLVDRSNVKNTTDLLSVVAHLKDFDEERRRLILHKTLVDECLGENAERKLADISAIEQNLSGFGMDFSGEKIKHIIDDLLPALAMKEPTILDKLRYIIAYALFRGGIIELDFIKLLNFIGVTHEHENFQQYLKIFRNYDLIDFKLIKDKPKDKPFQKEWFHDTLVNDPNIYHTSRFVPAVGNILSKVIANPLLLSEQYFPYLKDKPIELLNEEEFQAGLANTSANSSSSLRNPRHKAAWTTKSSNIKKNIPRQRFFYYVIGGISIPEIKAAYDQSNLKNRDIFIGSDEILTPTKFLDEVERLQNPREFFKFKEDQRQQVNPPDFLLREMKPVAQPVSHVHLKSQDNSPKSGTSSPKAAGSLKSEPPEKEKKRSKFSRFLKRKSHHDK mso1-sec1-1 3728105 N/A 3728107 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3728108 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 4 sec1-mso1-1 3728105 N/A 3728107 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3728108 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig 4 mso1-sec1-2 3728106 N/A 3728107 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3728108 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false Fig 5