IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bonvin-1994-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bonvin AM., Vis H., Breg JN., Burgering MJ., Boelens R., Kaptein R. Journal of molecular biology 1994 Only protein-protein interactions imex curation imex curation rarc_bpp22 Transcriptional repressor arc arc protein protein bpp22 Salmonella phage P22 Bacteriophage P22 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA arc-arc-1 3712536 N/A 3712537 unspecified role unspecified role neutral component neutral component purified purified arc repressor sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3712537 unspecified role unspecified role neutral component neutral component purified purified arc repressor sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 3712542 3712540 direct interaction direct interaction false false false Fig 3