UniProt UniProt http://www.uniprot.org keshav-1995-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Data pertaining to RPA2 was not added as authors believe this to be an auto-activator Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-3 rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes anti bait coip anti bait coimmunoprecipitation anti bait coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-4 in vitro In vitro pull down pull down weight identificat confirmation by molecular weight weight identificat Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. The method by which participantswere detected is unclear. The Materials and Methods state fluorography, the figure legend gives autoradiography as the method but gives no indication of any use of a radio-label, Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Human-HeLa cDNA Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-6 human-placenta Homo sapiens placenta placenta anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-7 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation keshav-1995-8 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Keshav KF., Chen C., Dutta A., Keshav KF., Chen C., Dutta A. Molecular and cellular biology 1995 Only protein-protein interactions imex curation imex curation rfa1_human Replication protein A 70 kDa DNA-binding subunit Replication factor A protein 1 Single-stranded DNA-binding protein RPA1 REPA1 RPA70 protein protein human Homo sapiens Human MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM rfa4_human Replication protein A 30 kDa subunit RPA4 Replication factor A protein 4 protein protein human Homo sapiens Human MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD rfa3_human Replication protein A 14 kDa subunit Replication factor A protein 3 RPA3 REPA3 RPA14 protein protein human Homo sapiens Human MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE single-stranded dna polynucleotide single-stranded DNA polynucleotide ssDNA polynucleotide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rpa1-rpa4-2 3940442 N/A 3940450 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined certain certain sequence position certain false N/A 3940451 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1 rpa3-rpa4-1 3940442 N/A 3940452 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3940451 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1 rpa1-rpa4-3 3940443 N/A 3940452 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 3940450 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined certain certain sequence position certain false N/A 3940451 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate association association false false false Fig. 5A rpa1-rfa3-1 3940443 N/A 3940452 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 3940453 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate N/A 3940450 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined certain certain sequence position certain false association association false false false Fig. 5A single_stranded dna polynucleotide-1 3940444 N/A 3940452 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 3940450 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 3940453 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 3940454 unspecified role unspecified role bait bait association association false false false Fig. 5B single_stranded dna polynucleotide-rpa1-1 3940444 N/A 3940452 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 3940450 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 3940454 unspecified role unspecified role bait bait N/A 3940451 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes association association false false false Fig. 5B rpa1-rpa4-1 3940445 N/A 3940450 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3940451 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false rpa1-rpa4-4 3940446 N/A 3940450 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3940451 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig.7A rpa1-rpa4-5 3940447 N/A 3940450 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3940451 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.7B rpa1-rpa4-6 3940448 N/A 3940453 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3940450 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.7B single_stranded dna polynucleotide-rpa1-2 3940449 N/A 3940450 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3940453 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3940454 unspecified role unspecified role bait bait association association false false false Fig. 7B