IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ viswanathan-2020-5 in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Viswanathan T Virus - Publications including interactions involving viral proteins guptay@uthscsa.edu 2020 Only protein-protein interactions imex curation imex curation Viswanathan T., Arya S., Chan SH., Qi S., Dai N., Hromas RA., Park JG., Oladunni F., Martinez-Sobrido L., Gupta YK. Coronavirus - Interactions investigated in the context of Coronavirus Nature communications viswanathan-2020-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Viswanathan T Virus - Publications including interactions involving viral proteins guptay@uthscsa.edu 2020 Only protein-protein interactions imex curation imex curation Viswanathan T., Arya S., Chan SH., Qi S., Dai N., Hromas RA., Park JG., Oladunni F., Martinez-Sobrido L., Gupta YK. Coronavirus - Interactions investigated in the context of Coronavirus Nature communications viswanathan-2020-6 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as fingerprinting peptide massfingerprinting fingerprinting Viswanathan T Virus - Publications including interactions involving viral proteins guptay@uthscsa.edu 2020 Only protein-protein interactions imex curation imex curation Viswanathan T., Arya S., Chan SH., Qi S., Dai N., Hromas RA., Park JG., Oladunni F., Martinez-Sobrido L., Gupta YK. Coronavirus - Interactions investigated in the context of Coronavirus Nature communications s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449628 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ 4254 4392 p0dtd1-pro_0000449633 2'-O-methyltransferase nsp16 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 6799 7096 (n(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) adenosine adenosine (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol 6-Amino-9-beta-D-ribofuranosyl-9H-purine 9-beta-D-Ribofuranosidoadenine 9-beta-D-ribofuranosyl-9H-purin-6-amine 9-beta-D-Ribofuranosyl-9H-purin-6-amine Ade-Rib Adenine Deoxyribonucleoside Adenocard Adenocor Adenoscan Adenosin ADENOSINE Adenosine adenosine Adenyldeoxyriboside Ado beta-D-Adenosine Deoxyadenosine Desoxyadenosine adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) me7gpppauagaacuucgucgaguacgcucaa me7GpppAUAGAACUUCGUCGAGUACGCUCAA rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) GAUAGAACUUCGUCGAGUACGCUCAA (n(7)_methyl 5'_triphospho_guanosine)_adenosine(2_)-rep-1 3710506 N/A 3710509 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3710510 unspecified role unspecified role neutral component neutral component purified purified red_dye tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3710511 unspecified role unspecified role neutral component neutral component purified purified red_dye tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3710506 Figure 2F (n(7)_methyl 5'_triphospho_guanosine)_adenosine(2_)-rep-2 3710506 N/A 3710511 unspecified role unspecified role neutral component neutral component purified purified region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3710512 unspecified role unspecified role neutral component neutral component adenosine_2′-O-ribose methylated residue carbohydrate chemical modification decreasing strength carbohydrate chemical modification decreasing interaction strength carbohydrate chemical modification decreasing strength undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 3710510 unspecified role unspecified role neutral component neutral component purified purified region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3710506 Figure 2F rep-rep-84 3710507 N/A 3710513 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3710509 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3710512 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3710510 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3710511 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Table 1 me7gpppauagaacuucgucgaguacgcucaa-rep-1 3710508 N/A 3710514 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 3'FAM fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain false 7me_Guanosine Triphosphate rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false r.2a>g mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3710510 ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3710511 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Figure 2G