IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ talsma-2019-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Talsma DT., Poppelaars F., Dam W., Meter-Arkema AH., Vivès RR., Gál P., Boons GJ., Chopra P., Naggi A., Seelen MA., Berger SP., Daha MR., Stegeman CA., van den Born J., null null. j.van.den.born@umcg.nl Frontiers in immunology 2019 Only protein-protein interactions imex curation imex curation talsma-2019-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Talsma DT., Poppelaars F., Dam W., Meter-Arkema AH., Vivès RR., Gál P., Boons GJ., Chopra P., Naggi A., Seelen MA., Berger SP., Daha MR., Stegeman CA., van den Born J., null null. j.van.den.born@umcg.nl Frontiers in immunology 2019 Only protein-protein interactions imex curation imex curation talsma-2019-3 human-kidney Human kidney kidney kidney [Renal] confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Talsma DT., Poppelaars F., Dam W., Meter-Arkema AH., Vivès RR., Gál P., Boons GJ., Chopra P., Naggi A., Seelen MA., Berger SP., Daha MR., Stegeman CA., van den Born J., null null. j.van.den.born@umcg.nl Frontiers in immunology 2019 Only protein-protein interactions imex curation imex curation mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI mannan mannan Mannan mannans Mannoglycan mannan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) o00187-1 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF heparan_sulfate Heparan_Sulfate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) heparin-dp4 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mannan-mbl2-7 3961663 N/A 3961666 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum N/A 3961667 unspecified role unspecified role bait bait purified purified yeast Saccharomyces cerevisiae Baker's yeast direct interaction direct interaction false false false 2 A/B None of the heparin preparations tested could inhibit MBL binding to mannan. heparin-masp2-3 3961663 N/A 3961668 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum N/A 3961669 unspecified role unspecified role bait bait purified purified physical association physical association false false false 5A heparin-masp2-4 3961663 N/A 3961669 unspecified role unspecified role bait bait purified purified N/A 3961670 unspecified role unspecified role prey prey purified purified CCP1-CCP2-SP sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4B heparin-masp2-1 3961664 N/A 3961669 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pig-intestinal mucosa pig Pig intestinal mucosa N/A 3961670 unspecified role unspecified role prey prey purified purified CCP1-CCP2-SP sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3961664 3, Supp.figure 1 MASP-2 showed similar affinity for the 6 kDa heparin and the 15 kDa heparin and HS (Heparan sulphate). heparan_sulfate-masp2-1 3961664 N/A 3961671 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pig-intestinal mucosa pig Pig intestinal mucosa N/A 3961670 unspecified role unspecified role prey prey purified purified CCP1-CCP2-SP sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3961664 3C, Supp.figure 1 MASP-2 showed similar affinity for the 6 kDa heparin and the 15 kDa heparin and HS (Heparan sulphate). heparin-masp2-2 3961664 N/A 3961672 competitor competitor competitor unspecified role unspecified role purified purified N/A 3961669 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pig-intestinal mucosa pig Pig intestinal mucosa N/A 3961670 unspecified role unspecified role prey prey purified purified CCP1-CCP2-SP sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3D heparan_sulfate-masp2-2 3961665 N/A 3961668 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3961671 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false 5,6 MASP-2 and HS showed partial co localization in some basement membranes of vascular structures and in Bowman's capsule.