IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kirketerp_mller-2020-3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P., Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P. From Ref. 29: pmid: 20053996, the protein MAP-1 corresponds to MASP1 isoform 3. It has been assumed that this protein, and other MASPS are of Human origin. peter.garred@regionh.dk Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation kirketerp_mller-2020-4 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P., Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P. peter.garred@regionh.dk Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation kirketerp_mller-2020-1 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P., Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P. peter.garred@regionh.dk Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation kirketerp_mller-2020-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P., Kirketerp-Møller N., Bayarri-Olmos R., Krogfelt KA., Garred P. peter.garred@regionh.dk Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation q9bxi9-2 Complement C1q tumor necrosis factor-related protein 6 C1QTNF6 CTRP6 UNQ581/PRO1151 protein protein human Homo sapiens Human MQWLRVRESPGEATGHRVTMGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD albu_bovin Albumin ALB BSA protein protein bovin Bos taurus (Bovine) Bovine MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA (1->3)-beta-d-glucan (1->3)-beta-D-glucan (1,3-beta-D-glucosyl)n (1,3-beta-D-Glucosyl)n (1,3-beta-D-Glucosyl)n+1 (1,3-beta-D-Glucosyl)n-1 1,3-beta-D-Glucan 1,3-beta-Glucan beta-(1,3)-glucan beta-1,3-glucan callose curdlan zymosan (1->3)-beta-D-glucopyranan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) l-fucose L-fucose (-)-fucose (-)-L-fucose L-(-)-fucose L-Fuc L-galactomethylose 6-deoxy-L-galactose L-fucose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9bwp8-1 Collectin-11 COLEC11 Collectin kidney protein 1 UNQ596/PRO1182 CL-K1-I protein protein human Homo sapiens Human MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM p48740-1 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI p48740-3 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKKNEIDLESELKSEQVTE p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER o00187-1 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF c1qtnf6-alb-1 3961702 N/A 3961706 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961707 unspecified role unspecified role bait bait purified purified acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 2 EDTA; CHEBI:42191 LPS derived from E. coli and S. typhi also bound to CTRP6, but the exact LPS molecules used are not possible to determine. (1_>3)_beta_d_glucan-c1qtnf6-1 3961702 N/A 3961706 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961708 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 2 EDTA; CHEBI:42191 LPS derived from E. coli and S. typhi also bound to CTRP6, but the exact LPS molecules used are not possible to determine. alb-c1qtnf6-1 3961702 N/A 3961708 competitor competitor competitor prey prey purified purified N/A 3961706 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961707 unspecified role unspecified role bait bait purified purified acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 3 alb-(1_>3)_beta_d_glucan-1 3961702 N/A 3961709 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961706 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961707 unspecified role unspecified role bait bait purified purified acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 4 colec11-c1qtnf6-1 3961702 N/A 3961706 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961710 unspecified role unspecified role bait bait purified purified crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 7, Supplemental Fig. 1 colec11-c1qtnf6-3 3961702 N/A 3961707 unspecified role unspecified role bait bait purified purified acres ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3961706 unspecified role unspecified role ancillary ancillary purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961710 unspecified role unspecified role prey prey purified purified crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 9 CL-11 bind to AcBSA only in the presence of CTRP6. colec11-c1qtnf6-4 3961702 N/A 3961711 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961712 unspecified role unspecified role bait bait purified purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false Supplemental Fig. 2 mbl2-masp1-3 3961702 N/A 3961713 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961712 unspecified role unspecified role bait bait purified purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false Supplemental Fig. 2 mbl2-masp1-4 3961702 N/A 3961714 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) N/A 3961712 unspecified role unspecified role bait bait purified purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false Supplemental Fig. 2 mbl2-masp1-5 3961702 N/A 3961715 unspecified role unspecified role prey prey purified purified crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961712 unspecified role unspecified role bait bait purified purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction false false false Supplemental Fig. 2 colec11-c1qtnf6-2 3961703 N/A 3961706 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961710 unspecified role unspecified role bait bait purified purified crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 8 c1qtnf6-1 3961703 N/A 3961706 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3961710 unspecified role unspecified role prey prey purified purified crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 8 c1qtnf6-c1qtnf6-1 3961704 N/A 3961706 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961706 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false 1C, Lane 2. c1qtnf6-c1qtnf6-2 3961705 N/A 3961706 unspecified role unspecified role neutral component neutral component purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961706 unspecified role unspecified role neutral component neutral component purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false 1C, Lane1.