IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ arrondel-2019-2 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation arrondel-2019-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation arrondel-2019-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation arrondel-2019-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation arrondel-2019-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column sequence tag sequence tag identification sequence tag Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation arrondel-2019-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation arrondel-2019-6 human-podocyte human podocyte podocyte renal glomerular podocyte anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G., Arrondel C., Missoury S., Snoek R., Patat J., Menara G., Collinet B., Liger D., Durand D., Gribouval O., Boyer O., Buscara L., Martin G., Machuca E., Nevo F., Lescop E., Braun DA., Boschat AC., Sanquer S., Guerrera IC., Revy P., Parisot M., Masson C., Boddaert N., Charbit M., Decramer S., Novo R., Macher MA., Ranchin B., Bacchetta J., Laurent A., Collardeau-Frachon S., van Eerde AM., Hildebrandt F., Magen D., Antignac C., van Tilbeurgh H., Mollet G. Rare diseases - Interactions investigated in the context of Rare genetic disease Pull down from Fig S13 has not been added as the interaction is not compliant to IMEx rules. geraldine.mollet@inserm.fr,herman.van-tilbeurgh@i2bc.paris-saclay.fr Nature communications 2019 Only protein-protein interactions imex curation imex curation osgep_human Probable tRNA N6-adenosine threonylcarbamoyltransferase t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEP OSGEP GCPL1 O-sialoglycoprotein endopeptidase tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP N6-L-threonylcarbamoyladenine synthase protein protein human Homo sapiens Human MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD gon7_human EKC/KEOPS complex subunit GON7 GON7 C14orf142 protein protein human Homo sapiens Human MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS lage3_human EKC/KEOPS complex subunit LAGE3 Protein ITBA2 Protein ESO-3 ITBA2 LAGE3 DXS9879E ESO3 L antigen family member 3 protein protein human Homo sapiens Human MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR prpk_human EKC/KEOPS complex subunit TP53RK TP53-regulating kinase TP53RK C20orf64 PRPK p53-related protein kinase Nori-2 Atypical serine/threonine protein kinase TP53RK protein protein human Homo sapiens Human MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRGRFQGRAAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQVLARMHDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG tprkb_human EKC/KEOPS complex subunit TPRKB PRPK-binding protein TPRKB TP53RK-binding protein CGI-121 My019 protein protein human Homo sapiens Human MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL gon7-lage3-3 3670641 N/A 3670648 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig. 5A and B, Fig. S6B and D and Table S4 gon7-lage3-4 3670641 N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false Fig. 5A and B, Fig. S6B and D and Table S4 gon7-lage3-7 3670642 N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. S12 gon7-lage3-6 3670642 N/A 3670648 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. S13B gon7-lage3-9 3670643 N/A 3670649 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3670650 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q14657:p.Val106Phe mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q14657:p.Phe137Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. S8B gon7-lage3-10 3670643 N/A 3670649 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3670650 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q14657:p.Val106Phe mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q14657:p.Phe137Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. S8B gon7-lage3-2 3670644 N/A 3670648 unspecified role unspecified role neutral component neutral component purified purified LAGE3 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified LAGE3 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified GON7 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false OSGEP binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 3670692 3670689 3670693 3670687 physical association physical association false false false Fig. 5C and D, Fig. S14 and Table S5 1.95A resolution R work: 0.186 R free: 0.217 gon7-lage3-5 3670645 N/A 3670651 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670652 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670648 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Table S9 and Fig. S13B C3 fraction gon7-lage3-8 3670646 N/A 3670650 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3670649 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 15N-labeled 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. S6A heuman-keops-1 3670647 N/A 3670651 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3670652 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3670649 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3670650 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3670648 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. S8A