IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ akiva-2017-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Akiva İ., Birgül Iyison N. Interaction between BRI3 isoform b (F5GXW6) and the bait proteins is indicated as weaker as compared to the interaction of BRI3 isoform a. No convincing control of IP efficiency is present. birgul@boun.edu.tr The detection of BRI3 in supplementary figure 1 was performed with an antibody against BRI3 in addition to an antibody against the tag (GFP). Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation akiva-2017-4 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Akiva İ., Birgül Iyison N. birgul@boun.edu.tr Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation akiva-2017-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akiva İ., Birgül Iyison N. Cotrasformation was performed to confirm positive clones The species identity of the BRI3 construct is not explicitly specified in the manuscript. I have inferred it is encoding for the human protein based on the sequence reported in figure 2. birgul@boun.edu.tr Human liver cDNA Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation akiva-2017-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akiva İ., Birgül Iyison N. birgul@boun.edu.tr The detection of BRI3 in supplementary figure 1 was performed with an antibody against BRI3 in addition to an antibody against the tag (GFP). Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation ifm3_human Interferon-induced transmembrane protein 3 IFITM3 Dispanin subfamily A member 2b Interferon-inducible protein 1-8U protein protein human Homo sapiens Human MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG mint bri3_human Brain protein I3 BRI3 pRGR2 protein protein human Homo sapiens Human MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA mgat1_human Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase MGAT1 GGNT1 GLCT1 MGAT GLYT1 N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I protein protein human Homo sapiens Human MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQDAEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGYDPSWN Initiates complex N-linked carbohydrate formation. Essential for the conversion of high-mannose to hybrid and complex N-glycans mint homomint bri3b_human BRI3-binding protein BRI3BP KG19 Cervical cancer 1 proto-oncogene-binding protein KG19 HCCRBP-1 protein protein human Homo sapiens Human MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK il7ra_human Interleukin-7 receptor subunit alpha IL7R CDw127 protein protein human Homo sapiens Human MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ bri3-ifitm3-2 3682095 N/A 3682099 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3a, suppl.1 bri3-mgat1-2 3682095 N/A 3682101 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3682100 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3a, suppl.1 bri3-bri3bp-1 3682095 N/A 3682102 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false There are no specific references to the vectors used for cloning. If the pcDNA3-HA backbone indicated in the manuscript is the following: https://www.addgene.org/browse/sequence/139830/ the HA tag should be at the N-terminus. This consideration is valid for all the HA-tagged constructs. n/a 3682100 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3a, suppl.1 bri3-ifitm3-3 3682095 N/A 3682099 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3b bri3-mgat1-3 3682095 N/A 3682101 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3b bri3-bri3bp-2 3682095 N/A 3682102 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3b bri3-ifitm3-4 3682096 N/A 3682099 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false The tag used for detection by confocal microscopy is a DsRed fusion protein. n/a 3682100 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4a bri3-mgat1-4 3682096 N/A 3682101 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4a bri3-mgat1-5 3682096 N/A 3682101 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4b bri3-ifitm3-5 3682096 N/A 3682099 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 3682100 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4b bri3-ifitm3-1 3682097 N/A 3682099 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3682100 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed The authors do not mention which isoform has been used to transform the bait strain. physical association physical association false false false 1a, suppl. table 1 bri3-mgat1-1 3682097 N/A 3682101 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3682100 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 1a, suppl. table 1 bri3-il7r-1 3682097 N/A 3682103 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3682100 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 1a, suppl. table 1 bri3-ifitm3-6 3682098 N/A 3682099 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3682100 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed The authors do not mention which isoform has been used to transform the bait strain. physical association physical association false false false 1b bri3-mgat1-6 3682098 N/A 3682101 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3682100 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 1b