IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fex-2017-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fex Svenningsen Å., Löring S., Sørensen AL., Huynh HUB., Hjæresen S., Martin N., Moeller JB., Elkjær ML., Holmskov U., Illes Z., Andersson M., Nielsen SB., Benedikz E. Results from Figure 3 (Protease Assays) have not been included as the source of HTRA1 is unpurified culture medium, also the species origin beta-casein is not stated - nor is it in the stated reference (13). aasvenningsen@health.sdu.dk human fetal brain cDNA library Cellular and molecular life sciences : CMLS 2017 Only protein-protein interactions imex curation imex curation fex-2017-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fex Svenningsen Å., Löring S., Sørensen AL., Huynh HUB., Hjæresen S., Martin N., Moeller JB., Elkjær ML., Holmskov U., Illes Z., Andersson M., Nielsen SB., Benedikz E. Results from Figure 3 (Protease Assays) have not been included as the source of HTRA1 is unpurified culture medium, also the species origin beta-casein is not stated - nor is it in the stated reference (13). aasvenningsen@health.sdu.dk human fetal brain cDNA library Cellular and molecular life sciences : CMLS 2017 Only protein-protein interactions imex curation imex curation fex-2017-3 in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Fex Svenningsen Å., Löring S., Sørensen AL., Huynh HUB., Hjæresen S., Martin N., Moeller JB., Elkjær ML., Holmskov U., Illes Z., Andersson M., Nielsen SB., Benedikz E. Results from Figure 3 (Protease Assays) have not been included as the source of HTRA1 is unpurified culture medium, also the species origin beta-casein is not stated - nor is it in the stated reference (13). aasvenningsen@health.sdu.dk Cellular and molecular life sciences : CMLS 2017 Only protein-protein interactions imex curation imex curation htra1_human Serine protease HTRA1 HTRA1 HTRA PRSS11 High-temperature requirement A serine peptidase 1 L56 Serine protease 11 protein protein human Homo sapiens Human MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP mif_human Macrophage migration inhibitory factor MIF MMIF GLIF Phenylpyruvate tautomerase Glycosylation-inhibiting factor L-dopachrome tautomerase L-dopachrome isomerase protein protein human Homo sapiens Human MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA mif-htra1-1 3671811 N/A 3671814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3671815 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 1 mif-htra1-2 3671812 N/A 3671814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3671815 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 Non-coding regions of HTRA1 cDNA clone were removed. When using HTRA1 constructs containing either the isolated PDZ domain or the part of the protease domain from the cDNA library, no interaction was found. mif-htra1-3 3671813 N/A 3671814 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false red_dye dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3671815 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false 3671813 2