DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ charenton-2016-1 klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Charenton C., Taverniti V., Gaudon-Plesse C., Back R., Séraphin B., Graille M. marc.graille@polytechnique.edu Nature structural & molecular biology 2016 Only protein-protein interactions imex curation imex curation charenton-2016-2 in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Charenton C., Taverniti V., Gaudon-Plesse C., Back R., Séraphin B., Graille M. marc.graille@polytechnique.edu Nature structural & molecular biology 2016 Only protein-protein interactions imex curation imex curation q6cx48_klula Enhancer of mRNA-decapping protein 3 KLLA0_A11308g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MLNFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQDGGVSPVFKIKADKLYDLKVLKLPPNANVKMNNGNGNGNGNGKQEKEKEKGKERDRFTEKADEIWDTEMSSDFDFQGNLQRFNKKDAFKDFQNVEIPKDETKIPHNEMVTAGNVKETTSDSDKITESINITHLLRNDSIAASLANQRKTFTCGSKNKIKVPLATPIQLLEMEKIADEKFMLPLKTSLEHSGIHISRLLRNMLKSYTPPATSDSDAVPTVVAFVSGGRSGSRCISALRCLLYIKDIRCIIVNPFINERESFDDDISTEQINKIKTLNNVHFPDSLAKLKELLQNEPPSIIIDALQGFDDTVSDLDFSPDSNDNIAQYIKWINSHETVSACLEVISFDCPAHIDPSSGDVIESDFVHPTTILSTGWPLHCLPKLTQILPDWRNTYVYDTGVPQQTYLLKPNLRKFYKLDIYPGFSGTQELK q6cpv9_klula KLLA0_E01827g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSTETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSSYDDTITGQQSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTDSFT q6ciu1_klula KLLA0_F23980g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSLPLLRPFETVSLENAVEDLVVRFILNVPPEDLSTVERVLFHFEEASWFYTDFVKLMNPYLPNLSIKSFSKIVIDICPLIWNWDITPENALVKFSNYKKTIPVRGAAIFNDSLSKILLLRGINSKHWSFPRGKIGKDEDDVACCIREVKEETGFDLTGFIDADQYVERNMNGKNFKIFLVKGVPEDFEFKPEHKNEIQAIEWKDFKKLSKAITKNEGSAKVFLVNSMIRPLSLYVKNEKRAKDENKLKLYAEEHLKSILGLNKKENKIVLDAGRELMEMLQKSAKTAQHQARNETYVAENPVVDVNQARSLFPLMSVQSVSHFSSSNNTNNNIVNGTGMTINTTGNNKLDHEKSYSTEQNTDLQASSKELLAFLHKSSTVNDKERQISGSDSVSSFPSAHFTEFTDDENYEEFESSSDESQYESSQEQLGHSDTEWDPNRDDELLTVKEPKSVKETQPSKPVKPETKQGATNNQKPILLKRPESQNKANNIESQTVKPKIRLLRRGDTLASATQSPSNESIKAVSEKRNDTETTSNKNAANDLLSILKKPSEDQPKINDSETHSNRSVANDLLSILKKPSRSEVPGAASSPLFTNTFENSQSSSSNASVEHHTSSNNDRNGSNFSKQFTASPALNEPSPKNDASDLMQLLKRPQQNSEPQSPISDLSPASKPSNELLNILKNPKTGLNSQISDDPVTHNTQYNRMPPLQVQPQQPFQMQQMQQMMPPPGYPPQNMSYIPQGFSPQQQFQYQQPINGYPMQPQPLNMGQPAPNQGFTKQQELLNILHKPNAPVQETPSNPSSELLSILKR q6ciu1_klula-q6cpv9_klula-1 3655160 N/A 3655162 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3655163 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified native native ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3655164 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig 1, Table 1, Supplementary Fig 2 q6ciu1_klula-q6cpv9_klula-2 3655160 N/A 3655163 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified native native ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3655164 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false Fig 1, Table 1, Supplementary Fig 2 q6ciu1_klula-q6cpv9_klula-3 3655161 N/A 3655162 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3655163 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified native native ecoli Escherichia coli (strain K12) N/A 3655164 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified native native HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Supplementary Fig 1