IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chiu-2016-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chiu YH., Chen H. In figure 5B, gal-GATA3-FLAG is stated to have 444 residues for GATA3;this must be isoform 2 as isoform 1 has only 443 residues. The length of GATA3 as used elsewhere in the publication is unknown. Results from figure 3C, using chimeric constructs, have not been annotated as per Imex guidelines. Details of pGal4-FLAG constructs were obtained from PMID:16166624 (Ref. 19). hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-8 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-1 human-bewo Homo sapiens bewo Human placenta choriocarcinoma BeWo cell line. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-4 human-bewo Homo sapiens bewo Human placenta choriocarcinoma BeWo cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-5 human-jeg3 Homo sapiens choriocarcinoma JEG3 jeg3 Human choriocarcinoma JEG3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-6 human-trophoblast human trophoblast trophoblast trophoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-7 human-bewo Homo sapiens bewo Human placenta choriocarcinoma BeWo cell line. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation chiu-2016-9 human-trophoblast human trophoblast trophoblast trophoblast confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Chiu YH., Chen H. hwchen@gate.sinica.edu.tw Scientific reports 2016 Only protein-protein interactions imex curation imex curation gcm1_human Chorion-specific transcription factor GCMa GCM1 GCMA GCM motif protein 1 Glial cells missing homolog 1 protein protein human Homo sapiens Human MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR gata3_human Trans-acting T-cell-specific transcription factor GATA-3 GATA3 GATA-binding factor 3 protein protein human Homo sapiens Human MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG p23771-2 Trans-acting T-cell-specific transcription factor GATA-3 GATA3 GATA-binding factor 3 protein protein human Homo sapiens Human MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG htra4_human_gene Serine protease HTRA4 HTRA4 gene gene human Homo sapiens Human gata3-gcm1-1 3676710 N/A 3676719 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3676720 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3B gata3-gcm1-2 3676710 N/A 3676719 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3676720 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3B gcm1-gata3-6 3676710 N/A 3676719 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminus gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3676720 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5A In addition, modest interaction was detected between HA-GATA3 and the region of amino acids 167–349 in GCM1, which constitutes the first TAD (TAD1) of GCM1. gcm1-gata3-7 3676710 N/A 3676719 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3676721 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminus gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N-terminal transactivation domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false delta Zinc finger 1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5B, Supp. fig 2. ZF1-deletion mutant GATA3 interacts with GCM1. htra4-gcm1-4 3676711 N/A 3676722 unspecified role unspecified role bait bait GBS promoter probe sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chr8:38,972,982-38,974,981 region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3676719 unspecified role unspecified role prey prey partially purified partially purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction false false false 6A htra4-gcm1-5 3676711 N/A 3676722 competitor competitor competitor unspecified role unspecified role GBS promoter probe sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chr8:38,972,982-38,974,981 chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3676722 unspecified role unspecified role bait bait GBS promoter probe sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chr8:38,972,982-38,974,981 region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3676719 unspecified role unspecified role prey prey partially purified partially purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 6A gcm1-htra4-2 3676712 N/A 3676722 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter region,GCM-binding site (GBS) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chr8:38981684-38981703 N/A 3676719 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 2D gcm1-gata3-1 3676713 N/A 3676719 unspecified role unspecified role bait bait partially purified partially purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3676720 unspecified role unspecified role prey prey partially purified partially purified C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 3D gcm1-gata3-2 3676714 N/A 3676720 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3676719 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 4A, number 1 gcm1-gata3-3 3676715 N/A 3676720 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3676719 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 4A, number 2 gcm1-gata3-4 3676716 N/A 3676720 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3676719 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 4A, number 3 gata3-gcm1-3 3676717 N/A 3676720 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3676719 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false 4B gcm1-gata3-5 3676718 N/A 3676720 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3676719 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false 4B