DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ battisti-2012-2 ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Battisti AJ., Meng G., Winkler DC., McGinnes LW., Plevka P., Steven AC., Morrison TG., Rossmann MG. mr@purdue.edu Proceedings of the National Academy of Sciences of the United States of America 2012 Only protein-protein interactions imex curation imex curation battisti-2012-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Battisti AJ., Meng G., Winkler DC., McGinnes LW., Plevka P., Steven AC., Morrison TG., Rossmann MG. mr@purdue.edu Proceedings of the National Academy of Sciences of the United States of America 2012 Only protein-protein interactions imex curation imex curation matrx_ndva Matrix protein M protein protein ndva Newcastle disease virus (strain Chicken/Australia-Victoria/32) NDV MDSSRTIGLYFDSALPSSNLLAFPIVLQDIGDGKKQIAPQYRIQRLDSWTDSKEDSVFITTYGFIFQVGNEEVTVGMISDNPKHELLSAAMLCLGSVPNVGDLVELARACLTMVVTCKKSATDTERMVFSVVQAPQVLQSCRVVANKYSSVNAVKHVKAPEKIPGSGTLEYKVNFVSLTVVPRKDVYKIPTAALKVSGSSLYNLALNVTIDVEVDPKSPLVKSLSKSDSGYYANLFLHIGLMSTVDKKGKKVTFDKLERKIRRLDLSVGLSDVLGPSVLVKARGARTRLLAPFFSSSGTACYPISNASPQVAKILWSQTARLRSVKVIIQAGTQRAVAVTADHEVTSTKIEKRHTIAKYNPFKK m-10 3728349 N/A 3728351 unspecified role unspecified role neutral component neutral component purified purified HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig S2, S4 m-11 3728349 N/A 3728351 unspecified role unspecified role neutral component neutral component purified purified HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3728351 unspecified role unspecified role neutral component neutral component purified purified HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig S2, S4 m-9 3728350 N/A 3728351 unspecified role unspecified role neutral component neutral component purified purified HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig 1, Fig S1, Table S1