DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhu-2011-46 thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhu J., Korostelev A., Costantino DA., Donohue JP., Noller HF., Kieft JS. Jeffrey.Kieft@ucdenver.edu Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Only protein-protein interactions imex curation rl35_thet2 50S ribosomal protein L35 rpmI TT_C0184 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPYE rl34_thet8 50S ribosomal protein L34 rpmH rpl34 TTHA0446 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR rl33_thet2 50S ribosomal protein L33 rpmG TT_C1735 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI rl32_thet2 50S ribosomal protein L32 rpmF rpl32 TT_C0050 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAKHPVPKKKTSKARRDARRSHHALTPPILVPCPECKAMKPPHTVCPECGYYAGRKVLEV rl31_thet2 50S ribosomal protein L31 rpmE TT_C0708 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR rl30_thet2 50S ribosomal protein L30 rpmD TT_C1310 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE rl29_thet2 50S ribosomal protein L29 rpmC TT_C1320 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA rl28_thet2 50S ribosomal protein L28 TT_C1964 rpmB protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELLKLL rl27_thet2 50S ribosomal protein L27 rpmA TT_C1423 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAHKKGLGSTKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA rl25_thet2 50S ribosomal protein L25 General stress protein CTC rplY ctc TT_C1225 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAEVAEPEVIKKGKEEEEE rl24_thet2 50S ribosomal protein L24 rplX TT_C1317 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE rl23_thet2 50S ribosomal protein L23 rplW TT_C1326 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI rl22_thet2 50S ribosomal protein L22 rplV TT_C1323 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK rl21_thet2 50S ribosomal protein L21 rplU TT_C1424 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIRG rl20_thet2 50S ribosomal protein L20 rplT TT_C0185 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG rl19_thet2 50S ribosomal protein L19 rplS TT_C0669 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQKAQEPEASQE rl18_thet2 50S ribosomal protein L18 rplR TT_C1312 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF rl17_thet2 50S ribosomal protein L17 rplQ TT_C1299 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLAERRRGDGAPLALVELVE rl16_thet2 50S ribosomal protein L16 rplP TT_C1321 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDFGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ rl15_thet2 50S ribosomal protein L15 rplO TT_C1309 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA rl14_thet2 50S ribosomal protein L14 rplN TT_C1318 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKAVVVRTKKEVKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL rl13_thet2 50S ribosomal protein L13 rplM TT_C1101 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV rl10_thet2 50S ribosomal protein L10 rplJ TT_C1777 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFVAKNTLIRLALKELGLPELDGLQGPSAVVFYEDPVAAAKTLVQFAKSNPKGIPQVKSGLLQGQILTAKDVEALAELPTMDELRAELVGVLQAPMAELVGVLGGVARELVGILEAYAEKKAA rl9_thet2 50S ribosomal protein L9 rplI TT_C1743 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEARIRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEALSRQHGITIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVAQE rl6_thet2 50S ribosomal protein L6 rplF TT_C1313 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK rl5_thet2 50S ribosomal protein L5 rplE TT_C1316 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK rl4_thet2 50S ribosomal protein L4 rplD TT_C1327 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA rl3_thet2 50S ribosomal protein L3 rplC TT_C1328 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRETKKAAK rl2_thet2 50S ribosomal protein L2 rplB TT_C1325 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK rshx_thet2 30S ribosomal protein Thx rpsU TT_C1030 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MGKGDRRTRRGKIWRGTYGKYRPRKKK rs20_thet2 30S ribosomal protein S20 rpsT rps20 TT_C1031 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA rs19_thet2 30S ribosomal protein S19 rpsS rps19 TT_C1324 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK rs18_thet2 30S ribosomal protein S18 rpsR rps18 TT_C1742 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK rs17_thet2 30S ribosomal protein S17 rpsQ rps17 TT_C1319 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA rs16_thet2 30S ribosomal protein S16 rpsP rps16 TT_C0673 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA rs15_thet2 30S ribosomal protein S15 rpsO rps15 TT_C0773 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG rs14z_thet2 30S ribosomal protein S14 type Z rpsZ rps14 rpsN TT_C1315 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW rs13_thet2 30S ribosomal protein S13 rpsM rps13 TT_C1303 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK rs12_thet2 30S ribosomal protein S12 rpsL rps12 TT_C1333 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK rs11_thet2 30S ribosomal protein S11 rpsK rps11 TT_C1302 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS rs10_thet2 30S ribosomal protein S10 rpsJ rps10 TT_C1329 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR rs9_thet2 30S ribosomal protein S9 rpsI rps9 TT_C1100 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR rs8_thet2 30S ribosomal protein S8 rpsH rps8 TT_C1314 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW rs7_thet2 30S ribosomal protein S7 rpsG rps7 TT_C1332 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW rs6_thet2 30S ribosomal protein S6 rpsF rps6 TT_C1740 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA rs5_thet2 30S ribosomal protein S5 rpsE rps5 TT_C1311 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG rs4_thet2 30S ribosomal protein S4 rpsD rps4 TT_C1301 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR rs3_thet2 30S ribosomal protein S3 rpsC rps3 TT_C1322 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE rs2_thet2 30S ribosomal protein S2 rpsB rps2 TT_C0509 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA rplb-rplc-3 3963582 N/A 3963583 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963584 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963585 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963586 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963587 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963588 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963589 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963590 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963591 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963592 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963593 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963594 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963595 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963596 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3963597 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963598 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963599 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963600 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963601 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963602 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963603 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3963604 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963605 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963606 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963607 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963608 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963609 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963610 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963611 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963612 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963613 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963614 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963615 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963616 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963617 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963618 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963619 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963620 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963621 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963622 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963623 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963624 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963625 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3963626 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963627 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 3963628 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963629 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963630 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3963631 unspecified role unspecified role neutral component neutral component purified purified sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false Fig 2, Fig S1, Table S1