IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hansen-2010-7 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation hansen-2010-1 crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation hansen-2010-4 human-plasma homo sapiens blood plasma plasma blood plasma elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation hansen-2010-2 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation hansen-2010-3 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom experimental particp experimental participant identification experimental particp Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation hansen-2010-5 crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column elisa enzyme linked immunosorbent assay ELISA ELISA elisa Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation hansen-2010-6 human-plasma homo sapiens blood plasma plasma blood plasma molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column elisa enzyme linked immunosorbent assay ELISA ELISA elisa Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. SHansen@health.sdu.dk Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation col11_mouse Collectin-11 Colec11 Collectin kidney protein 1 protein protein mouse Mus musculus Mouse MMMRDLALAGMLISLAFLSLLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDKENL d-mannose D-mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) albu_bovin Albumin ALB BSA protein protein bovin Bos taurus (Bovine) Bovine MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA methyl alpha-d-mannoside methyl alpha-D-mannoside 1-O-Methyl-alpha-D-mannopyranoside alpha-Methyl mannopyranoside alpha-methyl-D-mannoside Methyl-alpha-D-mannoside methyl alpha-D-mannopyranoside small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetyl-d-mannosamine N-acetyl-D-mannosamine 2-Acetamido-2-deoxy-D-mannose ManNAc N-acetylmannosamine WURCS=2.0/1,1,0/[a1122h-1x_1-5_2*NCC/3=O]/1/ 2-acetamido-2-deoxy-D-mannopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) d-glucose D-glucose D(+)-glucose D-(+)-glucose dextrose grape sugar Traubenzucker D-gluco-hexose D-glucose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetyl-d-glucoseamine N-acetyl-D-glucoseamine N-[(2S,3R,4S,5S,6R)-2,3,4,5-tetrahydroxy-6-(hydroxymethyl)oxan-2-yl]acetamide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) methyl d-glucoside methyl D-glucoside 1-O-Methyl-D-glucopyranose methyl D-glucopyranoside small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) d-galactose D-galactose D-Gal D-galacto-hexose D-galactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) col11_human Collectin-11 COLEC11 Collectin kidney protein 1 UNQ596/PRO1182 protein protein human Homo sapiens Human MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM masp1_human Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI q3sxb8-1 Collectin-11 Collectin kidney protein 1 Colec11 protein protein mouse Mus musculus Mouse MMMRDLALAGMLISLAFLSLLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDKENL mannose mannose Man mannose manno-hexose mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) alb-colec11-1 3961414 N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961441 3961439 direct interaction direct interaction false false false Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose. alb-colec11-2 3961414 N/A 3961424 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961449 3961447 direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by methyl alpha-D-mannoside. The carbohydrate stated to have been used was "alpha-Methyl-d-mannose", but as no such molecule can be found it has been assumed that "methyl alpha-D-mannoside" was the intended molecule. alb-colec11-3 3961414 N/A 3961422 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961457 3961455 direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by d-Mannose. alb-colec11-4 3961414 N/A 3961425 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961465 3961463 direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by n-acetyl-d-mannosamine. alb-colec11-5 3961414 N/A 3961426 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961473 3961471 direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by d-glucose. alb-colec11-6 3961414 N/A 3961427 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961481 3961479 direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by N-Acetyl-d-glucoseamine. alb-colec11-7 3961414 N/A 3961428 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum 3961489 3961487 direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by alpha-Methyl-d-glucose. As the molecule "alpha-Methyl-d-glucose" cannot be traced it has assumed to be "methyl alpha-D-glucose". alb-colec11-8 3961414 N/A 3961429 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961421 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3961422 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3961423 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bovin-serum Bovine serum serum Serum direct interaction direct interaction false false false 3961414 Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by d-Galactose. colec11-5 3961415 N/A 3961430 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction false false false 1 colec11-1 3961415 N/A 3961430 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false 1 colec11-masp1-1 3961416 N/A 3961431 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3961430 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 5A masp1-colec11-2 3961416 N/A 3961432 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3961431 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 5C colec11-6 3961417 N/A 3961433 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 3.0 direct interaction direct interaction false false false 1A mannose-colec11-1 3961418 N/A 3961431 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-plasma homo sapiens blood plasma plasma blood plasma N/A 3961430 fingerprinting peptide massfingerprinting fingerprinting sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-plasma homo sapiens blood plasma plasma blood plasma N/A 3961434 predetermined predetermined participant predetermined unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false 4B colec11-colec11-1 3961419 N/A 3961430 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3961430 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 6 CL-11 in plasma eluted within two broad peaks. One peak corresponded to a molecular mass of >950 kDa and the other to a molecular mass of 440 kDa. colec11-7 3961420 N/A 3961430 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3961430 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 6 CL-11 in plasma eluted within two broad peaks. One peak corresponded to a molecular mass of >950 kDa and the other to a molecular mass of 440 kDa.