MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint padhan-2007-1 human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Instead of punctate staining, the Δ3Cyto3a–HA protein showed a diffuse cytoplasmic distribution (Fig. 5cF5) and did not colocalize with caveolin-1. These results suggest that the presence of just one of the three potential caveolin-1-binding motifs is sufficient for the characteristic subcellular distribution of 3a and its colocalization with caveolin-1. shahid@icgeb.res.in The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation padhan-2007-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus shahid@icgeb.res.in The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation padhan-2007-3 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus shahid@icgeb.res.in The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation padhan-2007-4 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Instead of punctate staining, the Δ3Cyto3a–HA protein showed a diffuse cytoplasmic distribution (Fig. 5cF5) and did not colocalize with caveolin-1. These results suggest that the presence of just one of the three potential caveolin-1-binding motifs is sufficient for the characteristic subcellular distribution of 3a and its colocalization with caveolin-1. shahid@icgeb.res.in The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation padhan-2007-5 canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Instead of punctate staining, the Δ3Cyto3a–HA protein showed a diffuse cytoplasmic distribution (Fig. 5cF5) and did not colocalize with caveolin-1. These results suggest that the presence of just one of the three potential caveolin-1-binding motifs is sufficient for the characteristic subcellular distribution of 3a and its colocalization with caveolin-1. shahid@icgeb.res.in The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation cav1_canlf Caveolin-1 CAV1 CAV Vesicular integral-membrane protein VIP21 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET ap3a_sars ORF3a protein Protein 3a Accessory protein 3a Protein U274 Protein X1 3a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL ap3a_cvhsa-cav1-1 3707655 N/A 3707660 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3707661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a f5b ap3a_cvhsa-cav1-2 3707656 N/A 3707660 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3707661 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f6 ap3a_cvhsa-cav1-3 3707657 N/A 3707660 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3707661 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false f7a f7b f7c ap3a_cvhsa-cav1-4 3707658 N/A 3707660 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3707661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a f5b ap3a_cvhsa-cav1-5 3707659 N/A 3707661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3707660 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a f5b