UniProt UniProt http://www.uniprot.org liu-2005-4 in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay autoradiography autoradiography Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp Journal of immunology (Baltimore, Md. : 1950) 2005 Only protein-protein interactions imex curation imex curation liu-2005-2 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp Journal of immunology (Baltimore, Md. : 1950) 2005 Only protein-protein interactions imex curation imex curation liu-2005-3 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp Journal of immunology (Baltimore, Md. : 1950) 2005 Only protein-protein interactions imex curation imex curation fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA n-acetylglucosamine N-acetylglucosamine N-acetylglucosamines small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetylgalactosamine N-acetylgalactosamine GalNAc 2-Acetamido-2-deoxygalactose N-Acetylchondrosamine N-Acetylgalactosamine 2-acetamido-2-deoxygalactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 6-sialyl-n-acetyllactosamine 6-Sialyl-N-acetyllactosamine 5-acetamido-3,5-dideoxy-D-glycero-beta-D-galacto-non-2-ulopyranosylonic acid-(2->6)-beta-D-galacto-hexopyranosyl-(1->4)-2-acetamido-2-deoxy-D-gluco-hexopyranose NeuAc(b2-6)Gal(b1-4)GlcNAc WURCS=2.0/3,3,2/[a2122h-1x_1-5_2*NCC/3=O][a2112h-1b_1-5][Aad21122h-2b_2-6_5*NCC/3=O]/1-2-3/a4-b1_b6-c2 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) masp1_human Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint o00187-2 Mannan-binding lectin serine protease 2 MASP2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MAp19 Small MBL-associated protein sMAP protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSEQSL o00187-1 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF n_acetylglucosamine-fcn1-2 3931898 N/A 3931901 unspecified role unspecified role prey prey partially purified partially purified region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 3931902 unspecified role unspecified role bait bait partially purified partially purified direct interaction direct interaction false false false Fig. 6A, 6B n_acetyllactosamine-fcn1-1 3931898 N/A 3931901 unspecified role unspecified role prey prey partially purified partially purified region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 3931903 unspecified role unspecified role bait bait partially purified partially purified direct interaction direct interaction false false false Fig. 6A 6_sialyl_n_acetyllactosamine-fcn1-1 3931898 N/A 3931901 unspecified role unspecified role prey prey partially purified partially purified region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 3931904 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 6A fcn1-masp1-1 3931899 N/A 3931905 unspecified role unspecified role bait bait partially purified partially purified human-serum Homo sapiens serum Serum N/A 3931901 unspecified role unspecified role prey prey purified purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 3A,3C masp2-fcn1-1 3931899 N/A 3931906 unspecified role unspecified role bait bait partially purified partially purified human-serum Homo sapiens serum Serum N/A 3931901 unspecified role unspecified role prey prey purified purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 3BA, 3D Both O00187-1 and O00187-2 were observed in the complex but it was not possible to know if one or both were interacting with the prey n_acetylglucosamine-1 3931900 N/A 3931901 unspecified role unspecified role prey prey partially purified partially purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 3931905 unspecified role unspecified role prey prey partially purified partially purified human-serum Homo sapiens serum Serum N/A 3931907 unspecified role unspecified role prey prey partially purified partially purified human-serum Homo sapiens serum Serum N/A 3931908 unspecified role unspecified role prey prey partially purified partially purified human-serum Homo sapiens serum Serum N/A 3931902 unspecified role unspecified role bait bait association association false false false Fig. 4 n_acetylglucosamine-fcn1-1 3931900 N/A 3931901 unspecified role unspecified role prey prey partially purified partially purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 3931902 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 4