UniProt UniProt http://www.uniprot.org kojima-2004-1 ecoli Escherichia coli (strain K12) chromatography chromatography technology column chromatography chromatography western blot western blot Immuno blot Immuno blot Kojima S., Blair DF. Complex purified by solubulization from a membrane fraction using ,n-dodecylphos-phocholine, followed by pull down on His-Bind resin, and gel filtration. Western blot performed using a mixture of MOTA/B antibodies so molecular weight determination included in identification blair@bioscience.utah.edu Biochemistry 2004 Only protein-protein interactions imex curation imex curation kojima-2004-2 ecoli Escherichia coli (strain K12) pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kojima S., Blair DF. Complex purified by solubulization from a membrane fraction using ,n-dodecylphos-phocholine, followed by pull down on His-Bind resin, and gel filtration. Western blot performed using a mixture of MOTA/B antibodies so molecular weight determination included in identification blair@bioscience.utah.edu Biochemistry 2004 Only protein-protein interactions imex curation imex curation motb_ecoli Motility protein B motB b1889 JW1878 Chemotaxis protein MotB protein protein ecoli Escherichia coli (strain K12) MKNQAHPIIVVKRRKAKSHGAAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAEYFRTPLATAVTGGDRISNSESPIPGGGDDYTQSQGEVNKQPNIEELKKRMEQSRLRKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFRTGSADVEPYMRDILRAIAPVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVGMAATMRLSDRGPDDAVNRRISLLVLNKQAEQAILHENAESQNEPVSALEKPEVAPQVSVPTMPSAEPR mota_ecoli Motility protein A flaJ motA b1890 JW1879 Chemotaxis protein MotA protein protein ecoli Escherichia coli (strain K12) MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKALPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADSVMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAAVMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQCVKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQQTTTEEA mota-motb-1 3716507 N/A 3716509 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3716510 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figs. 4, 5 mota-motb-2 3716508 N/A 3716509 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 3716510 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false Figs. 7