DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gomis_rth-2003-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Gomis-Rüth FX., Dessen A., Timmins J., Bracher A., Kolesnikowa L., Becker S., Klenk HD., Weissenhorn W. weissen@embl-grenoble.fr Structure (London, England : 1993) 2003 Only protein-protein interactions imex curation imex curation gomis_rth-2003-2 ecoli Escherichia coli (strain K12) comigration in sds comigration in sds page comigration in sds experimental particp experimental participant identification experimental particp Gomis-Rüth FX., Dessen A., Timmins J., Bracher A., Kolesnikowa L., Becker S., Klenk HD., Weissenhorn W. weissen@embl-grenoble.fr Structure (London, England : 1993) 2003 Only protein-protein interactions imex curation imex curation vp40_ebozm Matrix protein VP40 VP40 Ebola VP40 Membrane-associated protein VP40 protein protein ebozm Zaire ebolavirus (strain Mayinga-76) ZEBOV Zaire Ebola virus MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK vp40-1 3726914 N/A 3726916 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 31-212 binding region 31-212 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 55-194 binding region 55-194 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 direct interaction direct interaction false false false Fig 1, Table 1 vp40-2 3726915 N/A 3726916 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 31-212 binding region 31-212 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 5