IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sunde-1996-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sunde M., Richardson SJ., Chang L., Pettersson TM., Schreiber G., Blake CC. N/A European journal of biochemistry 1996 Only protein-protein interactions imex curation imex curation tthy_chick Transthyretin TTR Prealbumin TBPA protein protein chick Gallus gallus (Chicken) Chicken MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE ttr-9 3638484 N/A 3638485 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chick Gallus gallus (Chicken) Chicken Stoichiometry: 4.0 direct interaction direct interaction false false false Fig. 2 Rwork=0.199 Rfree=N/A 2.9A