DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ masson-2019-1 in vitro In vitro oxidase oxidase assay oxidase experimental particp experimental participant identification experimental particp Masson N., Keeley TP., Giuntoli B., White MD., Puerta ML., Perata P., Hopkinson RJ., Flashman E., Licausi F., Ratcliffe PJ. peter.ratcliffe@ndm.ox.ac.uk Science (New York, N.Y.) 2019 Only protein-protein interactions imex curation imex curation rgs5_human Regulator of G-protein signaling 5 RGS5 protein protein human Homo sapiens Human MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK aedo_human 2-aminoethanethiol dioxygenase ADO C10orf22 Cysteamine dioxygenase protein protein human Homo sapiens Human MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP rgs4_human Regulator of G-protein signaling 4 RGS4 protein protein human Homo sapiens Human MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA ado-rgs5-1 3581338 N/A 3581339 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified CysO2H CysO2H cyso2h L-cysteine sulfinic acid (2R)-2-amino-3-sulfinopropanoic acid 2-amino-2-carboxyethanesulfinic acid 2-amino-3-(dioxido-lambda(6)-sulfanyl)propanoic acid [tautomer] 2-amino-3-sulfonylpropanoic acid [tautomer] 3-sulfinoalanine 3-sulphinoalanine L-cysteine sulfinic acid MOD_RES Cysteine sulfinic acid (-SO2H) S-cysteinesulfinic acid S-sulfinocysteine cysteine sulphinic acid cysteine-S,S-dioxide [tautomer] CysO2H Dioxidation dihydroxy sulfinicacid modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false 2-15 binding region 2-15 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3581340 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false Fig 3. Fig S14 ado-rgs4-1 3581338 N/A 3581341 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified 2-15 binding region 2-15 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false CysO2H CysO2H cyso2h L-cysteine sulfinic acid (2R)-2-amino-3-sulfinopropanoic acid 2-amino-2-carboxyethanesulfinic acid 2-amino-3-(dioxido-lambda(6)-sulfanyl)propanoic acid [tautomer] 2-amino-3-sulfonylpropanoic acid [tautomer] 3-sulfinoalanine 3-sulphinoalanine L-cysteine sulfinic acid MOD_RES Cysteine sulfinic acid (-SO2H) S-cysteinesulfinic acid S-sulfinocysteine cysteine sulphinic acid cysteine-S,S-dioxide [tautomer] CysO2H Dioxidation dihydroxy sulfinicacid modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3581340 predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false Fig S13, Fig S14