IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ scheidecker-2019-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast lexa b52 complement lexa b52 complementation LexA B52 transcription complementation lexa b52 complement predetermined predetermined participant predetermined Scheidecker S., Bär S., Stoetzel C., Geoffroy V., Lannes B., Rinaldi B., Fischer F., Becker HD., Pelletier V., Pagan C., Acquaviva-Bourdain C., Kremer S., Mirande M., Tranchant C., Muller J., Friant S., Dollfus H. Origin of KARS, p38 for Y2H and tags & orientation details of the constructs were taken from PMID 9878398 s.friant@unistra.fr,dollfus@unistra.fr Human mutation 2019 Only protein-protein interactions imex curation imex curation scheidecker-2019-2 human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Scheidecker S., Bär S., Stoetzel C., Geoffroy V., Lannes B., Rinaldi B., Fischer F., Becker HD., Pelletier V., Pagan C., Acquaviva-Bourdain C., Kremer S., Mirande M., Tranchant C., Muller J., Friant S., Dollfus H. Control or patient fibroblasts s.friant@unistra.fr,dollfus@unistra.fr Human mutation 2019 Only protein-protein interactions imex curation imex curation aimp2_crigr Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 Multisynthase complex auxiliary component p38 Protein JTV-1 AIMP2 JTV1 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MPMYQVKSYHGGSAPLRVELPTCMYRLPNVHSKTTSPATDAGHVQETSEPSLQALESRQDDILKRLYELKAAVDGLSKMIHTPDADLDVTNILQADEPVPLTTNALDLNLVLGKDYGALKDIVINANPASPPISLLVLHRLLCERYRVLSTVHTHSSVKNVPENLLKCFGEQARKQSRHEYQLGFTLIWKNVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKHSAVNLTLIDSWVDIAMFQLKEGSSKERAAVFRSMNSALGKSPWLVGNELTVADVVLWSVLQQTGDGSGVAPANVQRWLKSCENLVPFSTALQLLK syk_crigr Lysine--tRNA ligase KARS1 KARS Lysyl-tRNA synthetase protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MATLQECKVKVDGEPKLSKNELKRRLKAEKKLAEKEAKQKELIEKQLSQAAAAAATNHTADNGVGVEEETLDPNQYYKIRSQAIHQLKVSGEDPYPHKFHVDISLTQFIQEYSQLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFVRINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIVRAKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMLSGMVKSITGSYKITYHPDGPEGEAYEIDFTPPFRRISMVEELEKALGVKLPETSLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVTMFLTDSNNIKEVLLFPAMKPEDKKETAAATETLESTTAGPSV aimp2_human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 Protein JTV-1 AIMP2 PRO0992 JTV1 Multisynthase complex auxiliary component p38 protein protein human Homo sapiens Human MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK q15046-1 Lysine--tRNA ligase KARS1 KARS KIAA0070 Lysyl-tRNA synthetase protein protein human Homo sapiens Human MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV aimp2-kars-12 3579803 N/A 3579805 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3579806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P37879:p.Pro200Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P37879:p.Phe263Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6a kars-aimp2-6 3579803 N/A 3579805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3579806 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P37879:p.Pro200Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P37879:p.Phe263Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6a aimp2-kars-13 3579804 N/A 3579807 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3579808 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Q15046-1:p.Pro200Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q15046-1:p.Phe263Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6c the interacting protein was observed in the control samples and only barely detectable in the patient Co-IP samples. kars-aimp2-5 3579804 N/A 3579807 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3579808 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Q15046-1:p.Pro200Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q15046-1:p.Phe263Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6c the interacting protein was observed in the control samples and only barely detectable in the patient Co-IP samples.