DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ li-2019-1 ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Li Y., Orlando BJ., Liao M. maofu_liao@hms.harvard.edu Nature 2019 imex curation Only protein-protein interactions imex curation li-2019-2 ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Li Y., Orlando BJ., Liao M. maofu_liao@hms.harvard.edu Nature 2019 imex curation Only protein-protein interactions imex curation lptg_ecoli Lipopolysaccharide export system permease protein LptG lptG yjgQ b4262 JW5760 protein protein ecoli Escherichia coli (strain K12) MQPFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDALGAGMYTLLSVPKDVQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAIGEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYIERVKGDEELGGISIYAFNENRRLQSVRYAATAKFDPEHKVWRLSQVDESDLTNPKQITGSQTVSGTWKTNLTPDKLGVVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIIGALLPSASFFLISLWLLMRKS mint lptf_ecoli Lipopolysaccharide export system permease protein LptF lptF yjgP b4261 JW4218 protein protein ecoli Escherichia coli (strain K12) MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWAGPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPKGNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVALDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASFSRKGAV mint lptc_ecoli Lipopolysaccharide export system protein LptC lptC b3199 JW3166 yrbK protein protein ecoli Escherichia coli (strain K12) MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP lptb_ecoli Lipopolysaccharide export system ATP-binding protein LptB lptB b3201 JW3168 yhbG protein protein ecoli Escherichia coli (strain K12) MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLGEDFRL lptb-lptc-2 3564578 N/A 3564580 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3564581 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3564582 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3564583 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Fig. 3, Extended Data Table 1 lptb-lptf-2 3564578 N/A 3564580 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3564581 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3564583 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Fig. 1 and 3, Extended Data Table 1 lptb-lptc-3 3564579 N/A 3564580 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) N/A 3564581 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) N/A 3564582 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 3564583 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) association association false false false Extended Data Fig 1f lptb-lptf-3 3564579 N/A 3564580 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) N/A 3564581 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) N/A 3564583 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) association association false false false Extended Data Fig 1c