UniProt UniProt http://www.uniprot.org xu-2019-1 human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation xu-2019-2 human-lovo Homo sapiens colon adenocarcinoma cell line lovo lovo colon adenocarcinoma cell line lovo anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation xu-2019-3 human-colorectal_cancer human Human colorectal_cancer fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation xu-2019-4 human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation xu-2019-5 human-lovo Homo sapiens colon adenocarcinoma cell line lovo lovo colon adenocarcinoma cell line lovo anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation xu-2019-6 human-lovo Homo sapiens colon adenocarcinoma cell line lovo lovo colon adenocarcinoma cell line lovo fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation xu-2019-7 human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Xu C., Tian G., Jiang C., Xue H., Kuerbanjiang M., Sun L., Gu L., Zhou H., Liu Y., Zhang Z., Xu Q. zzhang@shsci.org Cell death & disease 2019 Only protein-protein interactions imex curation imex curation fzd6_human Frizzled-6 FZD6 protein protein human Homo sapiens Human MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT nptx2_human Neuronal pentraxin-2 NPTX2 Neuronal pentraxin II protein protein human Homo sapiens Human MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETVVQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLESLEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVLILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL nptx2-fzd6-1 3553357 N/A 3553364 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5C fzd6-nptx2-1 3553357 N/A 3553364 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5D fzd6-nptx2-2 3553358 N/A 3553364 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5D nptx2-fzd6-2 3553358 N/A 3553364 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 5C fzd6-nptx2-3 3553359 N/A 3553364 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 5E nptx2-fzd6-3 3553360 N/A 3553364 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 5B nptx2-fzd6-4 3553361 N/A 3553364 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 5B fzd6-nptx2-4 3553362 N/A 3553364 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Supp. Fig. 5C fzd6-nptx2-5 3553363 N/A 3553364 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3553365 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Supp. Fig. 5C