IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ maji-2019-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India This yeast two-hybrid experiment was performed under stringent conditions (SD-Trp/-Leu/-Ade/-His medium). Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in Nucleic acids research 2019 Only protein-protein interactions imex curation imex curation maji-2019-3 allium_epidermis Allium cepa (onion) epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in Nucleic acids research 2019 Only protein-protein interactions imex curation imex curation maji-2019-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India This yeast two-hybrid experiment was performed under less stringent conditions (SD-Trp/-Leu/-Ade (TDO) medium, instead of the more stringent SD-Trp/-Leu/-Ade/-His medium). Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in Nucleic acids research 2019 Only protein-protein interactions imex curation imex curation med11_arath Mediator of RNA polymerase II transcription subunit 11 MED11 MED11_1 T13O15 At3g01435 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPQTQNTSLQRLQNVENRVVKVLELAGGVMEELASPSGPKKEFVNSHCREFMQSMKDIQVTLREEIKSACEYRPFEKCDYNARIANEICFQKLEYVLTQLEDLKQTADRYPSSD med6_arath Mediator of RNA polymerase II transcription subunit 6 MED6_1 MHC9 At3g21350 MED6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSSLLSAATADTFNGNAADQIPPPLQPPGTDMTGISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRRRSIHPLDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKAFTDAASKLETIRQDLQVCLVAIVLSLSVNLGSYFLLIFKLMANGEQVYGFNKFLFDTENQNEPAESKPASETVDLKEMKRVDVILTSLYRKLAPPPPPPPFPEGYVSQEALGEKEELGTQGGESQPPQVDPIIDQGPAKRMKF med14_arath Mediator of RNA polymerase II transcription subunit 14 MED14 MED14_1 Protein STRUWWELPETER SWP F7O18.23 At3g04740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAELGQQTVDFSALVGRAAEESFLSFKELVDKSKSTELSDTEKKVSLLKYVAKTQQRMLRLNALAKWCKQVPLINYFQDLGSTLSAHDICFTQAADSLFFMHEGLQQARAPVYDVPSAVEILLTGSYQRLPKCLDDVGMQSSLDEHQQKPALRKLEVLVRSKLLEITLPKEITEVKISKGTVTLSVDGEFKVLVTLGYRGHLSMWRILHLDLLVGERSGPIKLEVTRRHILGDDLERRMSVAENPFTILYAVLHELCVAIVMDTVIRQVRALLQGRWKDAIRFDLISDTGTTPANQEGEADSVSLRTPGMKLFYWSDSDKNSGPFIKIEPGSDLQIKCSHSTFVIDPLTGKEAEFSLDQSCIDVEKLLLKAICCNRYTRLLEIQKELLRNTRICRTPSDVILQALLDEPGIEGDNMVDSKERVEPEVLRVRAYGSSFFTLGINIRTGRFLLQSSKSILTSSILEEFEDALNQGSISAVDAFINLRSKSILHFFAAIGKFLGLEVYEHGFGINKVPKSLLDGSSILTLGFPDCESSHLLLMELEKDFTPLFKLLETQMDGSGKPQSFNDPSNILRAKKIDIGQIRILEDDLNLITSDVVKFVSSFSDAEGINQASGHRQPGLVDEALTEMSGSQLSFSSVVDGVFGLQKVTSALMSIDGHGLVPKNLSAVTGHGKAPMLTSYHSDSLYNRQGPLQSSSYNMLSSPPGKGSAMKKIAISNSDQELSLILSPSLSTGNGVSESGSRLVTESSLSPLPLSQTADLATSSAGPLLRKDQKPRKRSASDLLRLIPSLQVVEGVASPNKRRKTSELVQSELVKSWSPASQTLSTAVSTSTKTIGCSYGNLIAEANKGNAPSSVFVYALLHVVRHSSLSIKHAKLTSQMEALDIQYVEEMGLRDAFSDIWFRLPFAQNDSWQHICLQLGRPGSMCWDVKINDQHFRDLWELQKGSKTTPWGSGVHIANSSDVDSHIRYDPEGVVLSYQSVEADSIKKLVADIQRLSNARMFSLGMRKLLGIKPDEKTEECSANSTMKGSTGGKGSGEPVDRWRAFKIEAVGLTSLWFSFGSGVLARFVVEWESGKDGCTMHVSPDQLWPHTKFLEDFINGAEVESLLDCIRLTAGPLHALAAATRPARASTATGMPVVPATASSRQSNQIQQTQGIIAPSTLAAPNATGQSASATSGNTVASSAPSPLGGGFHGVAMLAAAGRSGPGIVPSSLLPIDVSVVLRGPYWIRIIYRKRFAVDMRCFAGDQVWLQPATPPKGGASIGGSLPCPQFRPFIMEHVAQELNGLEPNLTGSQGATNPNSGNPTVNGVNRVNFSPSSARAAMNRVASVASGSLVVSSGLPVRRTPGTAVPAHVRGELNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLREILGSILKDNEGALLNLDQEQPALRFFVGGYVFAVSVHRVQLLLQVLSVRRFHHQAQQNGSSAAAQEELTQSEIGEICDYFSRRVASEPYDASRVASFITLLTLPISVLREFLKLIAWKKGLSQSQQAGEIAPAQRPRIELCLENHSGTDLDNNCAAKSNIHYDRPHNTVDFALTVVLDPVHIPHINAAGGAAWLPYCVSVRLRYTFGENPSVTFLGMEGSHGGRACWQRVDDWEKCKQRVSRTVEVNGSAAGDLTQGKLKLVADSVQRTLHLCLQGLREGGNNNNNTHQKEFTI med9_arath Mediator of RNA polymerase II transcription subunit 9 MED9_1 T7N22.3 At1g55080 MED9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQFSGGGGNWSMIPNVQAQGNFGTPTNHDQQLFLQQQQLQQQQQQQQQQQFHLQQQQQTQQQQQQFQPQQQQEMQQYQQFQQQQHFIQQQQFQQQQRLLQSPPLQPQSLQSPPPQQTMVHTPQSMMHTPQQQQQLVQTPVQTPQQHQSLASHFHLYPMVEKLADVIENGTRDQNSDALVNELNSHFDKCQQLLNSISGSLGSKTMTVDGQKRNVEESEQLLQQRRDLIVEYRKSIEEIVTMEH med31_arath Mediator of RNA polymerase II transcription subunit 31 MED31 MED31_1 Mediator complex subunit 31 Mediator complex subunit SOH1 F28I16.60 At5g19910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASPEEMGDDASEIPSPPKNTYKDPDGGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVPPQPPVAPSTSLPPAPSATAALSPALSPMQYNNMLSKNDTRNMGATGIDRRKRKKGI med4_arath Mediator of RNA polymerase II transcription subunit 4 MED4 MED4_1 F9G14.160 At5g02850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLQHQIVQSPARLGLTGPGSPSVQNPTPTRHGHPTSSSSSQSQHQQIQQQPNLLPSSTVAAASSASASAAVSSSALLSLLPPLPRAQALLQQMAVLTSKLFDVSPNRAIWLSAFRGSLPSFLSSHSLPPPPPLENPSPSSTKEILSQFNSLQTQLFEAVTELQEILDLQDAKQKVAREIKSKDSSLLAFANKLKDAERVLDMLVDDYSDYRKPKRSKIEEDDEDNDNESSSSSTTVSSQLKLKDILAYAHKISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYTFADLDIGLPKTVENMEKKVEALIEPPPPPEAMDISAIHNLLPPNIAVPSGWKPGMPVELPRDLPLPPPGWKPGDPVVLPPLESIAAPRAEDHQHMRPSQGLHRPPDVIQVRAVQLDILEDDDSSDYSSDDASSDDED med27_arath Mediator of RNA polymerase II transcription subunit 27 MED27 MED3 MED3_1 Mediator of RNA polymerase II transcription subunit 3 F3L24.5 MZB10.22 At3g09180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQTLHQSQLLQNPAEAANNQSESDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASQPRHTDMPLQLFLREDASMRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHIDDGLKMEPSSKKHRASHLLLENGREEPVDYKTLPDIQSRLEKLVPSVKVSTYGRLNWLKRANSLPGSGSDDPTEASKPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLSPAGSVDPDAVAFFSPDEGGSYLHARGFSVYHVYKHITEHAATALQYFLGFGTGTALYSLLLWICSFESVFSKPCTKCGRLLAMDKKSALILPPLHRAYQELPLALNLDVCEAYHSSCSQDDT med32_arath Mediator of RNA polymerase II transcription subunit 32 MED32 MED2 MED29 MED2_1 Mediator of RNA polymerase II transcription subunit 2 F25C20.9 At1g11760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNIVDSLNKAYEKFVLASAGVLESKESAGGQKALLTDTALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTTAAGGQAPAAVTGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGVAPGSVHSSSTGFDSRFSEDSTQ md15a_arath Mediator of RNA polymerase II transcription subunit 15a MED15A MED15_2 F7H2.12 At1g15780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNNNWRPSLPNGEPAMDTGDWRTQLPPDSRQKIVNKIMETLKKHLPFSGPEGINELRRIAARFEEKIFSGALNQTDYLRKISMKMLTMETKSQNAAGSSAAIPAANNGTSIDSIPTNQGQLLPGSLSTNQSQAPQPLLSQTMQNNTASGMTGSTALPSSMPPVSSITNNNTTSVVNQNANMQNVAGMLQDSSGQHGLSSNMFSGPQRQMLGRPHAMSSQQQQQPYLYQQQLQQQLLKQNFQSGNVPNPNSLLPSHIQQQQQNVLQPNQLHSSQQPGVPTSATQPSTVNSAPLQGLHTNQQSSPQLSSQQTTQSMLRQHQSSMLRQHPQSQQASGIHQQQSSLPQQSISPLQQQPTQLMRQQAANSSGIQQKQMMGQHVVGDMQQQHQQRLLNQQNNVMNIQQQQSQQQPLQQPQQQQKQQPPAQQQLMSQQNSLQATHQNPLGTQSNVAGLQQPQQQMLNSQVGNSSLQNNQHSVHMLSQPTVGLQRTHQAGHGLYSSQGQQSQNQPSQQQMMPQLQSHHQQLGLQQQPNLLQQDVQQRLQASGQVTGSLLPPQNVVDQQRQLYQSQRTLPEMPSSSLDSTAQTESANGGDWQEEVYQKIKSMKETYLPDLNEIYQRVAAKLQQDSMPQQQRSDQLEKLRQFKTMLERMIQFLSVSKSNIMPALKDKVAYYEKQIIGFLNMHRPRKPVQQGQLPQSQMQPMQQPQSQTVQDQSHDNQTNPQMQSMSMQGAGPRAQQSSMTNMQSNVLSSRPGVSAPQQNIPSSIPASSLESGQGNTLNNGQQVAMGSMQQNTSQLVNNSSASAQSGLSTLQSNVNQPQLSSSLLQHQHLKQQQDQQMQLKQQFQQRQMQQQQLQARQQQQQQQLQARQQAAQLQQMNDMNDLTSRQGMNVSRGMFQQHSMQGQRANYPLQQLKPGAVSSPQLLQGASPQMSQHLSPQVDQKNTVNKMGTPLQPANSPFVVPSPSSTPLAPSPMQVDSEKPGSSSLSMGNIARQQATGMQGVVQSLAIGTPGISASPLLQEFTSPDGNILNSSTITSGKPSATELPIERLIRAVKSISPQALSSAVSDIGSVVSMVDRIAGSAPGNGSRASVGEDLVAMTKCRLQARNFMTQEGMMATKKMKRHTTAMPLSVASLGGSVGDNYKQFAGSETSDLESTATSDGKKARTETEHALLEEIKEINQRLIDTVVEISDDEDAADPSEVAISSIGCEGTTVRFSFIAVSLSPALKAHLSSTQMSPIQPLRLLVPCSYPNGSPSLLDKLPVETSKENEDLSSKAMARFNILLRSLSQPMSLKDIAKTWDACARAVICEYAQQFGGGTFSSKYGTWEKYVAAS med17_arath Mediator of RNA polymerase II transcription subunit 17 MED17 MED17_1 F5O24.60 At5g20170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSDMEISLDRLPIKRLESIEENGAERFPSDVDYDDKRVSLIRRIDFAWALEEEDELKKKKQKKSSKDSVEQWKWKGMVENLQLAHQELTVIIDLIDTVQANDAVTVAGMTRPKPMPNEILSDLAVSTATKLQGYRNLGNYFKQSAKALEQKINREARFYGALIRLQRNWKVKRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPSTLSTIRVDHDSAGMLAINVPQDSWYSLRFGYVGLNPIGNSNESDEHIDSTTGHDIPGTSEKLSASDDKYVKETHSLLREVHKSIFAEQLFDMLNREAFNEGVGFNISGLRENFMEMSIGQGASLFVSLHPSGKNPSIKKSESATLLIESSGRVEPAEGGDYRLKKLGFPNRTSYEIYLQQIFHEHAFGKAKDQLKSKSIRASNQTEKDSNSGLLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQGRSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSINKYECDVADLPVMILQQVASQIVCWLLEEARTVGTKASREFLSLSLEIVEGERVSLVAHVNPEDAKGCISWWLVMENGCTEEREGVSESRKLLGHLSLDVLYSVLMDLINLCGTGRNALERL md10a_arath Mediator of RNA polymerase II transcription subunit 10a MED10_2 MJC20.1 At5g41910 MED10A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQTQNTIAGIGEINGSIKTEINAIATVDDSNEKLNQIINSNQKILELLHQLKLTVSSFTPASQLHLLQRLNSLVMELDNMAKLSDKCNIQVPIEVLNLIDDGKNPDEFTKDVLNKNCIAKNQVTKGKSDAFKGLRKHLLEELEQAFPDEVDRYRDIRASYAAEAKRLAQTQSVLPNGDAKVKSEL med7a_arath Mediator of RNA polymerase II transcription subunit 7a MED7A MED7_1 F15A17.250 F9G14.160 At5g03220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATATYPPPPPYYRLYKDYSENPNSAPEPPPPIEGTYVCFGGNYTTEDVLPSLEEQGVPQLYPKDSNLDYKNELRSLNRELQLHILELADVLVDRPSQYAKRIGEISSIFKNLHHLLNSLRPHQARATLIHIMELQIQQRKQAVEDIKRRREEAQRLLKDAYLTLDGQ md22b_arath Mediator of RNA polymerase II transcription subunit 22b MED22_1 T6D22.4 At1g07950 MED22B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNKGGGSGGGSGGGSGPTAAAAAAALQKQKALLQRVETDITSVVDNFTQIVNVSRVSDPPVKNSQETYMMEMRASRMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIEEFDQEAEKTNRLLARIADDASANLKELESHYYSSAQRLTLDI med18_arath Mediator of RNA polymerase II transcription subunit 18 MED18 MED18_1 F14M13.23 At2g22370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSMECVVQGIIETQHVEALEILLQGLCGVQRERLRVHELCLRSGPNLGVVSSEVRLLCDLDQPEPTWTVKHVGGAMRGAGADQISVLVRNMIESKVSKNALRMFYALGYKLDHELLKVGFAFHFQRTAHISVSVSSVNKMPKVHAIDEAVPVTPGMQIVDVTAPATSENYSEVAAAVSSFCEFLAPLVHLSKPSISTGVVPTAAAAAASLMSDGGGTTL md20a_arath Mediator of RNA polymerase II transcription subunit 20a MED20A MED20_1 T3B23.10 At2g28230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVKWVLHWQPNQGSTVSSQILNEATQCVESINGVKEGRWKATLNYYKPMLKDQANQLEFPRDFLGISLADQPNKYYFIIRTQRIVLEADSSIQLIMEKLQSYKSKVALYFDGFQYQLGDFRLRVGKVVPTHSENVRGIVMEVEYLPISSMEKAQKVMEEFLEIWNEALAKRSLPGKFVNIDLNFGEFGLGDIYTPQHTAVRYALVMAHMIATVQAVRG md19a_arath Mediator of RNA polymerase II transcription subunit 19a MED19_1 MXC9.19 At5g12230 MED19A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEPERLKFGGPRELCGAADLISQFKLVQHHEFFCKKSLPVSLSDSHYLHNVVGDTEIRKGEGMQLDQLIESISQSRETNIRIQPFDIDELQESFQLNDMTPVELPPAEKGAPTIPSKSKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGDEDLNDVQRHKKNKHKSSKLDEVGAIRVAG med21_arath Mediator of RNA polymerase II transcription subunit 21 Mediator complex subunit 21 RNAPII complex component SRB7 MED21 MED21_1 SRB7 T4B21.7 At4g04780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIISQLQEQVNTIAAITFNAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAKQFDALVAALPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE med6-med11-1 3533068 N/A Med11 3533071 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med6 3533072 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med6-med6-1 3533068 N/A Med6 3533072 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med6 3533072 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med6-med14-1 3533068 N/A Med14 3533073 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med6 3533072 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med31-med9-1 3533068 N/A Med9 3533074 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med31 3533075 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S5 med31-med6-1 3533068 N/A Med6 3533072 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med31 3533075 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med31-med4-1 3533068 N/A Med4 3533076 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med31 3533075 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl fig. S6A med32-med27-1 3533068 N/A Med3 3533077 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med2 3533078 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl fig. S6C med32-med15a-1 3533068 N/A Med15A 3533079 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med2 3533078 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med14-med17-1 3533068 N/A Med17 3533080 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med14 3533073 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3A, Supp. Figure 8A med14-med10a-1 3533068 N/A Med10A 3533081 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med14 3533073 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S8B med14-med6-1 3533068 N/A Med6 3533072 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med14 3533073 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Suppl. figure S8A The full length of Med14 did not show any binding, the interaction was only detected with non-full length fragment(s). med15a-med15a-1 3533068 N/A Med15A 3533079 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med15A 3533079 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med7a-med10a-1 3533068 N/A Med10A 3533081 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med7A 3533082 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Suppl. figure S6B The full length of Med10A did not show any binding, the interaction was only detected with non-full length fragment(s). med11-med6-1 3533068 N/A Med6 3533072 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med11 3533071 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med11-med22b-1 3533068 N/A Med22B 3533083 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A Med11 3533071 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S4B med17-med17-1 3533068 N/A Med17 3533080 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med17-med11-7 3533068 N/A Med11 3533071 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3C The full length of Med17 did not show any binding, the interaction was only detected with non-full length fragment(s). med17-med10a-1 3533068 N/A Med10A 3533081 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S8B med17-med6-1 3533068 N/A Med6 3533072 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3C The full length of Med17 did not show any binding, the interaction was only detected with non-full length fragment(s). med17-med22b-1 3533068 N/A Med22B 3533083 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3A, C med17-med4-1 3533068 N/A Med4 3533076 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med17-med18-1 3533068 N/A Med18 3533084 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3C The full length of Med17 did not show any binding, the interaction was only detected with non-full length fragment(s). med17-med14-1 3533068 N/A Med14 3533073 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med17 3533080 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med18-med20a-1 3533068 N/A Med20 3533085 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A Med18 3533084 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S4D med19a-med19a-1 3533068 N/A Med19A 3533086 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med19A 3533086 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med20a-med18-1 3533068 N/A Med18 3533084 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med20 3533085 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S4C med22b-med11-1 3533068 N/A Med11 3533071 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med22B 3533083 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S4A med4-med31-1 3533068 N/A Med31 3533075 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med4 3533076 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S5 med4-med10a-1 3533068 N/A Med10A 3533081 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med4 3533076 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Suppl. figure S6B The full length of Med10A did not show any binding, the interaction was only detected with non-full length fragment(s). med10a-med32-1 3533068 N/A Med2 3533078 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med10A 3533081 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A med10a-med10a-1 3533068 N/A Med10A 3533081 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med10A 3533081 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S5 med10a-med7a-1 3533068 N/A Med7A 3533082 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med10A 3533081 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl. fig. S5 med10a-med4-1 3533068 N/A Med4 3533076 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A Med10A 3533081 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Figure 3A, suppl fig. S6A, suppl. fig. S5 med10a-med14-1 3533068 N/A Med10 3533081 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med14 3533073 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3A, suppl. fig. S8A med11-med22b-2 3533069 N/A Med22B 3533083 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med11 3533071 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med18-med20a-2 3533069 N/A Med20 3533085 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med18 3533084 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med21-med7a-1 3533069 N/A Med21 3533087 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med7A 3533082 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med21-med9-1 3533069 N/A Med21 3533087 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med9 3533074 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med31-med9-2 3533069 N/A Med31 3533075 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med9 3533074 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med4-med9-2 3533069 N/A Med9 3533074 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med4 3533076 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med31-med7a-1 3533069 N/A Med31 3533075 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med7A 3533082 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med27-med32-1 3533069 N/A Med3 3533077 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med2 3533078 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med15a-med32-1 3533069 N/A Med15A 3533079 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A Med2 3533078 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3B med4-med9-1 3533070 N/A Med9 3533074 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med4 3533076 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Figure S5 med4-med4-1 3533070 N/A Med4 3533076 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A Med4 3533076 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Supplementary Figure S5