UniProt UniProt http://www.uniprot.org sayas-2018-1 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Sayas CL., Medina M., Cuadros R., Ollá I., García E., Pérez M., Ferrer I., Hernández F., Avila J. javila@cbm.csic.es PloS one 2018 Only protein-protein interactions imex curation imex curation sayas-2018-2 in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Sayas CL., Medina M., Cuadros R., Ollá I., García E., Pérez M., Ferrer I., Hernández F., Avila J. javila@cbm.csic.es PloS one 2018 Only protein-protein interactions imex curation imex curation tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL mare3_human Microtubule-associated protein RP/EB family member 3 End-binding protein 3 EB1 protein family member 3 RP3 MAPRE3 protein protein human Homo sapiens Human MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY mapt-mapre3-2 3542835 N/A 3542837 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3542838 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] physical association physical association false false false Fig.2A-C mapt-mapre3-3 3542835 N/A 3542837 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) N/A 3542838 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] physical association physical association false false false Fig.3A mapt-mapre3-1 3542836 N/A 3542839 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] N/A 3542837 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3542838 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] association association false false false Fig.2D Only very low amounts of MAPRE1 detected